KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_3060Help
Entry
PSTAA_3060        CDS       T01976                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSTAA_3060
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSTAA_3060
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSTAA_3060
Enzymes [BR:psr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSTAA_3060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3241177..3242388
Genome map
AA seq 403 aa AA seqDB search
MTSYRNGPDAKGLFGHFGGQYVAETLMPLIHELAAEYEKAKADPEFAKELAYFQRDYVGR
PSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLAKRMGKQRIIAETGAGM
HGVATATVAARFGMQCVIYMGTTDIDRQQANVFRMKLLGAEVIPVTAGTGTLKDAMNEAL
RDWVTNVHNTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQMMEKEGRLPDSLVACIGGG
SNAMGLFHPFLDDASVKIIGVEAAGHGIETGQHAASLNGGVPGVLHGNRTFLLQNEDGQI
IDAHSISAGLDYPGIGPEHAWLHDIGRVEYTSITDKEALKAFHTCCRLEGIIPALESSHA
LAEVFKRAPGLPKDHLMVVNLSGRGDKDMQTVMHHYDEQEEHI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacctcataccgcaacggccctgacgccaagggcctgttcggccacttcggtggtcag
tacgtcgccgaaacgctgatgccgctcatccacgagctggccgccgagtacgaaaaagcc
aaggccgaccccgagttcgccaaggagctcgcctacttccagcgcgactacgtgggccgc
ccctcgccgctgtacttcgccgagcgcctgaccgaacactgcggcggcgcgaagatctac
ctcaagcgcgaagagctcaaccacaccggcgcgcacaagatcaacaactgcatcggccag
atcctgctggccaagcgcatgggcaagcagcgcatcatcgccgagaccggcgccggcatg
cacggcgtggccactgccaccgtggccgcgcgcttcggcatgcagtgcgtgatctacatg
ggcaccaccgacatcgaccgccagcaggccaacgtcttccgcatgaagctcctgggcgcc
gaagtgattccggtcaccgccggcaccggcaccctgaaggacgcgatgaacgaagccctg
cgcgactgggtgaccaacgtccacaacaccttctacctgatcggcaccgtcgccggaccg
cacccctaccccgccatggtccgcgacttccaggccgtgatcggcaaggaaacccgcgag
cagatgatggaaaaggaaggtcgcctgcccgactcgctggtggcctgtatcggtggcggc
tccaatgccatgggcctgttccatccgttcctggatgacgccagtgtgaagatcatcggc
gtcgaggcggccgggcacggtatcgagaccggccagcacgcggcgagcctgaacggcggc
gtacccggcgtactgcacggcaaccgcaccttcctcctgcagaacgaggatggccagatc
atcgacgcccactcgatctccgccggcctggactaccccggcatcggcccggaacacgcc
tggctgcacgacatcggccgcgtcgagtacacctcgatcaccgacaaggaagcgctcaag
gctttccatacctgctgccgcctggaaggcatcatcccggcgctggagtcctcccacgcg
ctggctgaagtattcaagcgcgcgcctggtctgccgaaggatcacctgatggtggtcaac
ctctccggccgcggcgacaaggacatgcagaccgtcatgcaccactacgacgaacaggaa
gaacatatatga

DBGET integrated database retrieval system