KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_3061Help
Entry
PSTAA_3061        CDS       T01976                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSTAA_3061 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSTAA_3061 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSTAA_3061 (trpA)
Enzymes [BR:psr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSTAA_3061 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3242385..3243194
Genome map
AA seq 269 aa AA seqDB search
MSRLQTRFDELKQQNRAALVTFITAGDPDYATSLQILKGLPAAGADVIELGMPFTDPMAD
GPAIQLANIRALAAKQDLAKTLQMVREFRQDNQTTPIVLMGYFNPIHKMGVERFIAEAVE
AGVDGLIVVDLPPEHNEDLCDPAQAAGIDFIRLTTPTTDDKRLPVVLNGSSGFVYYVSVA
GVTGAGSATLEHVEEAVARLKRHTELPVCVGFGIRTPEQAAAIARLTEGVVVGSALIDQI
ANAKSNAQAVECVLELCRQISTGVRGARA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcagacgcgcttcgacgagctgaaacaacagaaccgcgccgcactggtg
accttcatcaccgccggcgatccggactacgccacttcgctgcagatcctcaagggcctg
ccggccgcgggtgctgacgtcatcgaactgggcatgccctttaccgacccgatggccgac
ggcccggcgatccagctggccaacatccgcgccctcgccgccaagcaggacctggccaag
acgctgcagatggttcgagaattccgccaggacaaccagaccaccccgatcgtgctgatg
ggctacttcaaccccatccacaagatgggcgtggagcgcttcatcgccgaggcggtggaa
gccggcgtcgacggcctgatcgtggtcgacctgccgccggagcacaacgaagacctctgc
gaccccgcccaggccgcgggcatcgacttcatccgcctgaccaccccgaccaccgatgac
aagcgcctgccggtggtactcaacggtagctccggcttcgtctattacgtctcggtggcc
ggcgtgaccggtgccggttcggcgacgctcgagcatgtcgaggaagccgtggcgcgcctc
aagcgccataccgagctgccggtttgcgtcggcttcggcatccgcacgccggaacaggcc
gccgccatcgcccggctgaccgaaggggtggtagtgggctcggcgctgatcgatcagatc
gccaatgccaagagcaacgcacaggccgtcgaatgcgtgctggaactgtgccgccagatc
agtaccggcgtgcgcggcgcccgcgcctga

DBGET integrated database retrieval system