KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_3352Help
Entry
PSTAA_3352        CDS       T01976                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00900  Terpenoid backbone biosynthesis
psr01100  Metabolic pathways
psr01110  Biosynthesis of secondary metabolites
psr01130  Biosynthesis of antibiotics
Module
psr_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSTAA_3352 (ipk)
Enzymes [BR:psr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PSTAA_3352 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEA85221
UniProt: F2N2T7
Position
3552718..3553578
Genome map
AA seq 286 aa AA seqDB search
MQVLTLPAPAKLNLMLHITGRRADGYHELQTLFQFLDYGDELVLRPREDGQIRLLTELPG
VDHDSNLIVRAARLLQRESGCALGADIQLTKRLPMGGGIGGGSSDAATTLVGLDHLWNTR
LGEDRLAELGLNLGADVPVFVRGRAAFAEGVGERLQPVDLPEPWFLVIAPQVSVSTAEIF
ADPELTRNTPAITVRSLLAGGGHNDCQPVVEKRYPEVRNALSLLNKFVQARMTGTGACVF
GSFPNEGEADKVRRQLPATLPSFVARGRNVSMLHRSLERMAQEASA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtactgaccctgccggcgccggccaagctcaatctgatgctgcacatcacaggg
cgccgtgccgatggctatcacgagctgcagaccctgttccagttcctcgattacggtgac
gaactggtcttgcgtccgcgagaggatgggcagattcgcctgctcaccgaattgccaggc
gtggaccacgacagcaacctgatcgtccgtgccgcacgcttgctgcagcgcgaaagcggc
tgcgcgctgggcgccgacatccagctgaccaagcgcttgcccatgggcggcggaatcggc
ggcggcagctcggatgccgccaccaccctggtcggcctagaccatctgtggaataccaga
cttggcgaagatcgcctggccgaactgggcctgaacctcggggccgatgtaccggtgttc
gtccgcggtcgcgcggccttcgccgaaggggtcggagagcgcctgcaaccggtcgatcta
cccgaaccctggttcctcgtcatagcgccgcaagtctctgttagtacagcggaaatattt
gccgacccggagttgacacgtaataccccggccattacagttcgcagccttcttgcaggg
ggcggtcataacgactgtcagccggtggtcgagaagcgttatcccgaagttcgtaacgct
ttgagcttgttgaacaaattcgttcaggcaaggatgaccggcactggagcttgtgtgttt
gggagcttcccaaacgagggcgaggctgataaagtccgccgccaacttccagccactttg
ccgagtttcgtggcccgcggccgcaacgtctcgatgttgcaccgaagcctggaacggatg
gcacaggaagcgagtgcgtag

DBGET integrated database retrieval system