KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_3352Help
Entry
PSTAA_3352        CDS       T01976                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:psr00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3552718..3553578
Genome map
AA seq 286 aa AA seqDB search
MQVLTLPAPAKLNLMLHITGRRADGYHELQTLFQFLDYGDELVLRPREDGQIRLLTELPG
VDHDSNLIVRAARLLQRESGCALGADIQLTKRLPMGGGIGGGSSDAATTLVGLDHLWNTR
LGEDRLAELGLNLGADVPVFVRGRAAFAEGVGERLQPVDLPEPWFLVIAPQVSVSTAEIF
ADPELTRNTPAITVRSLLAGGGHNDCQPVVEKRYPEVRNALSLLNKFVQARMTGTGACVF
GSFPNEGEADKVRRQLPATLPSFVARGRNVSMLHRSLERMAQEASA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtactgaccctgccggcgccggccaagctcaatctgatgctgcacatcacaggg
cgccgtgccgatggctatcacgagctgcagaccctgttccagttcctcgattacggtgac
gaactggtcttgcgtccgcgagaggatgggcagattcgcctgctcaccgaattgccaggc
gtggaccacgacagcaacctgatcgtccgtgccgcacgcttgctgcagcgcgaaagcggc
tgcgcgctgggcgccgacatccagctgaccaagcgcttgcccatgggcggcggaatcggc
ggcggcagctcggatgccgccaccaccctggtcggcctagaccatctgtggaataccaga
cttggcgaagatcgcctggccgaactgggcctgaacctcggggccgatgtaccggtgttc
gtccgcggtcgcgcggccttcgccgaaggggtcggagagcgcctgcaaccggtcgatcta
cccgaaccctggttcctcgtcatagcgccgcaagtctctgttagtacagcggaaatattt
gccgacccggagttgacacgtaataccccggccattacagttcgcagccttcttgcaggg
ggcggtcataacgactgtcagccggtggtcgagaagcgttatcccgaagttcgtaacgct
ttgagcttgttgaacaaattcgttcaggcaaggatgaccggcactggagcttgtgtgttt
gggagcttcccaaacgagggcgaggctgataaagtccgccgccaacttccagccactttg
ccgagtttcgtggcccgcggccgcaacgtctcgatgttgcaccgaagcctggaacggatg
gcacaggaagcgagtgcgtag

DBGET integrated database retrieval system