KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_3479Help
Entry
PSTAA_3479        CDS       T01976                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSTAA_3479 (tpiA)
   01230 Biosynthesis of amino acids
    PSTAA_3479 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAA_3479 (tpiA)
   00051 Fructose and mannose metabolism
    PSTAA_3479 (tpiA)
   00562 Inositol phosphate metabolism
    PSTAA_3479 (tpiA)
Enzymes [BR:psr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSTAA_3479 (tpiA)
Exosome [BR:psr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSTAA_3479 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSTAA_3479 (tpiA)
  Exosomal proteins of melanoma cells
   PSTAA_3479 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3686493..3687050)
Genome map
AA seq 185 aa AA seqDB search
MQSGFGALTGEVSADQLVDLGCEWVLVGHSERRLVLGETDEVVSQKFAAAQAGGLKPVLC
LGETLEEREAGRTLEVVARQLGQVLADQGVEAFQSAVIAYEPVWAIGSGLTATPEQAQEV
HAAIRDQLARSDRRIAEGVRLLYGGSVKADNAAELFAMADIDGGLVGGASLKADEFGAIC
RAAGN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgcagtcgggtttcggggcgctgactggcgaggtttcggccgaccagttggttgatctc
ggttgtgagtgggtattggttgggcactccgagcgccgcctggtattgggtgagacggac
gaggtggtcagccagaaatttgcggcagctcaggcaggcggtttgaagcctgtgctgtgc
ctcggtgagacgctcgaggagcgcgaggctggaagaacgctggaagtggtggcgcggcag
ttggggcaggttctcgctgatcaaggtgtcgaggcgttccagtctgcggtgattgcgtat
gagcccgtctgggccattgggtctggcttgacggctacgcctgagcaggcgcaagaggtg
cacgccgccattcgcgatcaactggcgcgcagcgatcgtcgcatcgccgaaggtgtaagg
ctgctgtatggtggcagcgtgaaggcggacaatgccgctgagctgttcgccatggcggat
attgatggggggctggttggtggagcctctctgaaagcagatgaattcggtgcgatctgt
cgcgccgcggggaactga

DBGET integrated database retrieval system