KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_3553Help
Entry
PSTAA_3553        CDS       T01976                                 

Gene name
recD-1
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSTAA_3553 (recD-1)
Enzymes [BR:psr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PSTAA_3553 (recD-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3781886..3783826)
Genome map
AA seq 646 aa AA seqDB search
MAKFILEQDPQAQASVLLAAAMTSHQLGRGHACLDLTATLAAPDFVLSLPPEGEEGSTLP
SQWLQGLDATQWRQALAASTLVEDRDARQDAPERPLVLVGLRLYLRRYWNYECSIAQALS
ARLSVAPVTPDNFASRLDELFPARSEAERAQGSNWQKIACALAARGNFSVITGGPGTGKT
TSVVRLLGLLQTPAVESGKPLRIRLAAPTGKAAARLSESIGKEVRVLPVSDAVRAEIPTD
VSTLHRLLGSRPNSRNFIHQRDKPLELDVLVVDEASMIDLEMMACVLDALPQAARLILLG
DKDQLASVEAGSVMGDLCREAEKGDYNAQTAQWLSTHSGEALVDPELQMAEGAGAPLAQQ
TVMLRRSWRFDPQKGIGRLAKLINNKQAGEARRALEQPSEQLFNLLVRGEQDAALSDLAI
DGNRNAPGYRHYLVQLRDLRPVADTQWDSELWAGWAGKVLSAFDQFRLLCALRRGPWGVE
GLNQRVATQLRRRGLLDSDHGWYEGRPVLVTRNDYSLNLMNGDIGIALWVPGPDGALALR
VAFPRNDGSGGVRFVMPSRLVEVETVFAMTVHKSQGSEFNHTALVLPDALNPVLTKELLY
TAITRAREWFSLAETHPGVFEGAVGRNVQRTSGLALQLHEALAQRI
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaaattcattcttgaacaagaccctcaggcccaggccagcgtgctgctggccgcc
gcgatgaccagccaccaactgggccgtggccatgcctgcctggaccttaccgccaccctg
gcagcgccggatttcgtgctgtcgttgccaccagaaggcgaggagggcagtacgctgccg
tcgcaatggttgcagggcctggacgctacgcagtggcgccaggctctggccgccagcacc
ctggtcgaggaccgtgacgcccgccaggacgcccccgagcggcccttggtgctggtgggg
ctgcgcctttacttgcgccgctactggaactacgagtgcagcatcgcccaagccttaagc
gcacgcttgagcgtggcgccggtcacaccagataacttcgctagccgtctcgatgaactg
tttcccgcccgttccgaagccgagcgcgcgcaaggcagcaattggcagaaaattgcctgc
gcgctggcggcccgtggcaacttcagcgtcatcactggcggcccgggcaccggcaagacc
acctcggtggtgcgcctgctggggttgctgcaaaccccggcggtcgagagcggcaagccg
ctgcgcatccgcctggcggcgccgaccggcaaggcggcggcgcggttgtccgagtccatt
ggcaaggaggttcgggtgttgccggtgagtgatgcggtgcgcgccgagatcccgacggat
gtgtccaccttgcaccgcttgctgggcagccgaccgaactcgcgcaacttcattcaccag
cgcgataaaccgctggagctggatgtactggtggtcgatgaagcctcgatgatcgacctg
gaaatgatggcctgcgtgctggatgccttgccccaggcagcgcgcttgattctgctaggc
gacaaggaccagttggcctcggtggaagccggttcggtgatgggcgacttgtgccgcgag
gctgaaaaaggcgactacaacgcgcaaaccgcccagtggctgagcacccacagcggtgag
gcgctggttgaccctgagttgcagatggccgaaggcgcgggtgccccgctggcgcagcag
accgtgatgttgcgccgctcttggcgtttcgacccgcagaagggtatcgggcgcctggcc
aagctgatcaacaacaagcaggcgggcgaagcacggcgtgcgctcgaacagccctcggag
caacttttcaacctgctggtgcgtggcgagcaggatgcggcgcttagcgacctggccatc
gatggcaaccgcaatgcgcccggctaccggcattacctggtgcaactgcgcgacttgcgc
cctgtggctgatacacagtgggacagcgagctatgggccggttgggcaggcaaggtgttg
tctgcattcgaccagttccgcctgctctgcgcattgcgccgggggccttggggcgtcgaa
gggcttaaccagcgtgtggctacgcaattgcgtcgccgaggcttgctggacagcgaccac
ggctggtacgaagggcgtccggtgctggtgacgcgcaatgactacagcttgaacctgatg
aacggcgatattggcatcgcgctatgggtgccggggccggacggtgcgctggccctgcgc
gtggccttcccgcgcaacgacggcagtggcggcgtgcgcttcgtgatgccgagccggttg
gtggaggtggagacggtgttcgccatgacggtgcacaagtcccagggctcggagttcaac
cacaccgcgctggtgttgcctgatgcgctgaacccggtgttgactaaggagctgctgtac
accgccatcacccgcgccagggaatggttcagcctggccgagactcacccgggtgtgttc
gaaggcgcggtgggccgcaacgtgcagcgcaccagcggcttggcgttgcaactgcatgag
gcgctggctcaacgcatctga

DBGET integrated database retrieval system