KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_3657Help
Entry
PSTAA_3657        CDS       T01976                                 

Definition
two-component hybrid sensor and regulator
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:psr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSTAA_3657
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PSTAA_3657
Enzymes [BR:psr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     PSTAA_3657
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PSTAA_3657
Two-component system [BR:psr02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PSTAA_3657
Bacterial motility proteins [BR:psr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PSTAA_3657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3909825..3913991
Genome map
AA seq 1388 aa AA seqDB search
MSTSPEPSVPKNSNLTRSTLQFPVVGIGASAGGLKALITLFESMPADCGMAFVVIMHLSP
KHESKADQILQKATRMPVLQVTQPTPIERNHIYVIPPALDLSMNDGYLRLTEPQRERGVQ
VAIDLFFRTLADTHHTHAIGIVLSGSGADGSVGLSRIKEQGGITLAQEPGDAEFESMPRS
AIETGMVDIVLPVADIAQKLVELHRNMQTLLEQFRPVPAPEDGEHPTVEPGEMDYIQAQP
QTKPNELALREILAALRTRTGHDFRHYKLATVLRRIERRMQVNALPDMPSYARYLQGNPE
ETPALLADMLIGVTNFFRDREAFEALERDIIPVLFEQKLATDDRALRVWAAACSTGEEAY
SLAMLLTDQAAHSGVDIQTQLFATDIDDHALETARAGVYPEAIVTDVTPARLRQYFVKDQ
NQLRLQKELRERILFARHNILRDPPFSRLDLISCRNLMIYLDRDIQIEVLRMFHFALNPG
GYLFLGSSETADVCSQLFTAVDKKNRIYRAKEVGSSLRRAPLGPVHGFTLSTPPRPPFSE
PHRRHRKFSFADVHQRALEQYAPPSVIVNQEAEIVHMSDRAGNFLRYVGGEPSLNLTTLV
HPQLRLELRTALYQAAHTGKSVEARRVRLERDGRSYYVNMVVRPFRDNEAGSDYMLVLFD
EVEACMDSSTLEDPDTKDSVLTQLEAELQHTKERLQITMEHSETSTEELRASNEELQAIN
EELRSATEELETSKEELQSINEELTTVNYELKSKVDETSKINDDLQNLISSTDIATVFVD
RKMRIKWFTPRARDIFNVIGNDAGRSLFDITHRLDYPLLAKDAAEAFEELHLVEREVRDR
EGQHWYLARFLPYRTLDDRIEGAVLTFIDITDRRRAEEELRAGEAHLKLLAQSTKGYAII
TLDCDGLITTWNCGAELILGYRETEVLGQTVDIIYTEQDRQAGVPEAERQRALQHGQATD
ERWHARRDGSRCFLSGLLNPLVDGTGKVIGFAKIARDLTEERQRSSEQQNELESVQAANL
QKDQFFAVLSHELKHPLNLIQLNTDLVARSQAVKNNPSLHKATQSIQNAVRSQSRIIDDL
MDVSRIRTGKLKLHFATLRYQDVLRGIEAVFAPLAQSENISFESFKPDAPIYIQADPTRL
DQIIWNLLNNAWKFTKGGQRICMQLEREGDQARLDVIDTGEGISADFLPKVFDMFGQAEM
QHAQRAKHGLGIGLALVKQLVEAHNGRIEAYSEGIGRGARFSVWLPVHLQTEFELSDLAN
ADDAGGLRGIRILLVDDSPDILETMCELLQSEGAEVTTADGGARAIELAEQTPFDVIVSD
IGMPEIDGHKMMAIIRQQGANRDTPSIALTGYGTLRDVEKAMAAGFTLHLRKPIDLQALI
DAVSQAVH
NT seq 4167 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccagccctgagccgtccgtgccgaagaacagcaacctgacccgcagcacgctg
cagtttcccgtggtcggtattggcgcctcggcaggcggcctcaaggcgcttatcacgctg
ttcgaaagcatgccggccgattgcggcatggccttcgtggtgatcatgcacctctcgccc
aaacacgagagcaaggccgaccagatcctgcagaaggcgacccgcatgccggtgctgcag
gtcacccagccgacgcccatcgagcgtaaccacatctacgtgattcccccggcgctggac
ctgtcgatgaacgacggctacctgcgcctgaccgagccgcagcgcgagcgcggcgtgcag
gtggccatcgacctgttcttccgcacgctggccgacacccaccacacccacgccatcggc
atcgtgctttccggcagcggtgccgacggttcggtggggctgtcgcgcatcaaggaacag
ggcggcatcaccctggcgcaggaacccggcgatgcggagttcgagtcgatgccgcgcagc
gccatcgaaaccggcatggtcgacatcgttctgccggtggccgacatcgcgcagaagctg
gtcgaactgcaccgcaacatgcagacgctgctcgagcagttccgcccggtgccggcgccc
gaggacggcgagcaccccacggtcgagccgggcgagatggactacatccaggcgcaaccc
cagaccaagcccaacgagctggcgctgcgcgagatcctcgccgcgctgcgcacccgcacc
ggccacgatttccgccattacaagctggccacggtgctgcgccgcatcgaacggcgcatg
caggtcaatgccctgcccgacatgcccagctatgcccggtatctgcagggcaacccggag
gaaaccccggcactgctggccgacatgctgatcggcgtgaccaacttcttccgcgaccgc
gaggccttcgaggcgctggaacgcgacatcatccccgtgctgttcgagcagaagctcgcc
accgatgaccgcgctctgcgggtctgggccgcagcctgctccaccggcgaggaagcctat
tcgctggccatgctgctcaccgaccaggccgcccacagcggggtcgacatccagacccag
ctgttcgccaccgacatcgacgatcacgccctggaaaccgcgcgcgccggcgtctacccc
gaggccatcgtcaccgacgtcaccccggcccgactgcgccagtacttcgtcaaggatcag
aaccagctgcgcctgcagaaggagctgcgcgagcggatcctcttcgcccgtcacaacatc
ctgcgcgacccgccgttctcgcggctcgacctgatctcctgccgcaacctgatgatctac
ctggaccgcgacatccagatcgaagtgctgcgcatgttccacttcgccctcaaccccggt
ggctacctctttctcggcagctccgaaaccgccgacgtctgcagccagctgttcaccgcg
gtggacaagaagaaccgcatctaccgcgccaaggaagtgggctcctcgctgcgccgcgcg
cccctcggcccggtgcacggcttcaccctcagcacgccgccgcgcccgccgttcagcgag
ccgcaccggcgccaccgcaagttctccttcgccgacgtacaccagcgtgcactggagcag
tacgcgccgcccagcgtcatcgtcaaccaggaggcggagatcgtgcacatgtccgaccgc
gccgggaacttcctgcgctatgtcggtggcgagccctcattgaacctgaccaccctggtg
catccccagttgcgcctcgaactgcgcaccgcgctgtaccaggccgcccacaccggcaag
agcgtcgaggctcggcgcgtgcgtctggagcgcgacggccgcagctactatgtgaacatg
gtggtgcgcccgttccgcgacaacgaggcaggcagcgactacatgctggtgctgttcgac
gaagtggaagcctgcatggacagcagcacgctggaggatccggacaccaaggacagcgtc
ctgacccagctcgaggcggaactgcagcacaccaaggagcgcctgcagatcaccatggag
cactcggaaacctccaccgaggaactgcgcgcctccaacgaggagctgcaggcgatcaac
gaggaattgcgctcggccaccgaggagctggaaaccagcaaggaagagctgcagtcgatc
aacgaagagctcaccaccgtcaactacgagctcaagagcaaggtcgacgagaccagcaag
atcaacgacgacctgcagaacctgatctcctccactgacatcgccacggtcttcgtcgac
cgcaagatgcgcatcaagtggttcaccccgcgtgccagggacatcttcaacgtgatcggc
aacgatgccggccgctcgctgttcgacatcacccatcggctggactacccgctgctggcc
aaggacgccgccgaagccttcgaagagctgcacctggtcgagcgcgaggtgcgcgaccgc
gagggccagcactggtacctggcgcgcttcctgccctatcgcacgctggacgaccgcatc
gaaggcgccgtgcttaccttcatcgacatcaccgaccgccgccgggccgaggaagagcta
cgcgccggcgaagcccacctcaagctgctggcgcagagcaccaagggctacgccatcatc
accctggactgtgacggcctgatcaccacctggaactgcggtgccgagctgatcctgggt
taccgcgaaaccgaagtgctcggccagacggtggacatcatctacaccgagcaggatcgc
caggccggtgttccggaagccgaacgccagcgcgcactgcaacatgggcaggccacggac
gagcgctggcacgcccgccgcgatggcagtcggtgcttcctcagcggcctgctcaatccg
ctggtggatggtacgggcaaggtcatcggcttcgccaagatcgcccgcgacctcaccgag
gaacgccagcgcagctccgaacagcagaacgaactggagagtgtgcaggcggccaacctg
cagaaggaccagttcttcgccgtactctcccacgagctgaagcacccgctgaacctcatc
cagctcaacaccgacctggtcgcccgctctcaggcggtgaagaacaacccgagcctgcac
aaggcgacgcagtcgatccagaacgcggtgcgcagccagtcgcggatcatcgacgacctg
atggatgtctcgcgcatccgcaccggcaagctcaagctgcacttcgccacgctgcgctat
caggacgtgctgcgcggcatcgaagcggtgttcgcaccgctggcacagagcgagaacatc
agcttcgagagcttcaagccggacgcccccatctacatccaggccgacccgacgcgcctg
gaccagatcatctggaacctgctgaacaacgcctggaagttcaccaagggcggccagcgc
atctgcatgcagctagagcgcgagggcgatcaggcccggctcgacgtcatcgacaccggc
gaaggcatcagcgccgacttcctgcccaaggtcttcgacatgttcggccaggccgagatg
cagcatgcgcagcgtgccaagcacgggctgggcatcggcctggcgctggtcaagcagctg
gtcgaggcgcacaacgggcgcatcgaggcctattcggaaggcatcggccgcggcgcgcgc
ttcagcgtctggctgccggtgcacctgcagaccgaattcgaactcagcgacctggccaat
gccgatgacgccggtgggctcaggggcatccgcatcctgctggtggacgactcgccggac
atcctcgaaaccatgtgcgagctgctgcaaagcgagggcgccgaggtcaccactgccgac
ggcggtgcgcgggccatcgagctggccgagcagacgccgttcgatgtgatcgtctccgac
atcggcatgccggagatcgacggccacaagatgatggccatcatccgccagcagggcgcc
aatcgggacaccccgagcatcgccctgaccggctacggcaccttgcgcgacgtggaaaag
gccatggccgcgggcttcaccctgcacctgcgcaagcccatcgacctgcaggcgctgatc
gacgcggtgagccaggcggtgcactga

DBGET integrated database retrieval system