KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_3947Help
Entry
PSTAA_3947        CDS       T01976                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:psr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:psr00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:psr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:psr00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4231538..4233544
Genome map
AA seq 668 aa AA seqDB search
MSETIRVPDIGSGEGEVIELFVKVGDRIEADQSILTLESDKASMEIPAPKAGVVKSLKVK
LGDRLKEGDELLELESEEGQDSAAPAQAAAEPAGAATGGPTDEAEAPTPPGDDDASASAG
EGETQEIKVPDIGSSGKASVIEIAVKAGDTIAAEQALITLESDKASMEIPSPAAGVIESI
SVKVGDEVGTGDLILILKGAASSKPAAGKAPASQAASAPKQKLSEPAAEEPAEAAGESVE
EVRIPDIGSSGSANVIEVMVKAGDSVEADQSLITLESDKASMEIPAPKAGVVESLSIKVG
DEAKTGDLILTLKVQGTAPAKKPAPKADEAAPQQQAVAPNKQGVPEAKAAATPAPAVSGP
SKAGTKVHAGPAVRMLAREFGVELTDVPATGPKGRILKEDVQAYVKNMLHKVKQAPAEGT
TGGAGIPPIPTIDFSKFGEVEEVPMTRLMQVGAANLHRSWLNVPHVTQFESADITELEAF
RVAQKAIAEKAGVKLTVLPLLLKACAHLLKELPDFNSSLAPSGKALIRKKYVHVGFAVDT
PDGLMVPVIRNVDQKSLLQLAGEAAELAEKARTKKLSPDAMQGACFTISSLGHIGGTGFT
PIVNAPEVAILGVSKAAMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLSELL
ADIRTMLL
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaaccatacgcgtacccgacatcggcagtggtgagggtgaagtaatcgaattg
ttcgtcaaggtcggcgaccgtatcgaagccgaccagagcatcctgacgctcgagtccgac
aaggccagcatggaaattccagcgcccaaggcgggcgtggtgaagagcctgaaggtcaag
ctcggcgatcgtctgaaagaaggcgacgagctgctggagctggaaagcgaagaaggccag
gacagtgcggctccggcacaggctgcagccgaacccgctggcgcagcgaccggcggcccg
acagatgaagccgaagcgccgacgcctccgggcgacgacgatgcttcggcctcggccggc
gaaggcgagacacaggagatcaaggttcctgatatcggctcctcgggcaaagccagcgta
atcgagatcgcggtcaaagccggcgataccattgccgccgaacaagcgttgatcacgctc
gagtcggacaaggccagcatggagattccgtctcctgccgccggcgtgatcgagagcatt
tcggtcaaggtgggcgacgaagtcggcaccggcgatctgatcctgattctcaaaggcgca
gcgtccagcaagccagcagcaggcaaggcgccagcaagccaggccgcaagcgctccgaag
caaaagctgagcgagccggcagctgaagagcctgccgaagccgccggcgaatccgtggaa
gaagtgcgtatcccggacatcggctccagcggcagcgccaatgtcatcgaagtgatggtc
aaggccggggacagcgtcgaggcggatcagtcgctgattacccttgagtccgacaaggcc
agcatggaaattcctgcgcccaaggcgggcgtggtggaatcgctgtcgatcaaggtcggt
gacgaggccaagaccggcgatctgatcctgaccctaaaggtccaaggcaccgcaccggcg
aagaaacccgctcccaaggcggatgaggctgcgccgcagcagcaggccgtcgcaccaaac
aagcaaggcgttcccgaggcgaaggctgccgcgacgccggctccggcggtcagcggcccg
agcaaggctggcaccaaggtgcacgcggggccggcggtacgcatgcttgcacgcgaattt
ggcgtagaactgactgatgttccggccactggcccgaagggacgcatcctcaaggaagac
gtccaggcctacgtcaagaacatgctgcacaaggtcaagcaggctcctgccgaaggtact
accggcggggcgggtattccgccgatcccgacgatcgacttcagcaagttcggtgaagtc
gaagaagtgccgatgacccgcctgatgcaggtcggtgccgccaacctgcatcgcagctgg
ctgaacgtaccgcacgtgacccagttcgagtcggccgacattaccgagctggaagctttc
cgcgttgcgcagaaggcgatcgccgagaaggctggggtcaagctcaccgtgctgccgcta
ttgctcaaggcgtgcgcgcacctgctaaaggaactgccggatttcaacagttccctggcc
ccgagcggcaaggcgctgatccgcaagaagtatgtgcacgtagggttcgccgtcgacacg
ccggatggcctgatggtcccggtgattcgcaacgtcgaccagaagagtctgctgcaactg
gccggcgaggctgcggagctggctgagaaggcccgcaccaagaagctttctccggatgcg
atgcagggcgcctgcttcacgatctccagcctcggccacatcggcggcaccggcttcacg
ccgatcgtcaatgcgccggaagtggcgatcctaggcgtctccaaggcggccatgcagccg
gtgtgggatggcaaggccttccagccccgcctgatgctgccgctgtcgctctcctacgac
caccgggtgatcaacggtgccgcggcggcgcgcttcaccaagcgcctgtcggagctgctg
gccgatatccgcaccatgctgctgtaa

DBGET integrated database retrieval system