KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_3947Help
Entry
PSTAA_3947        CDS       T01976                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00010  Glycolysis / Gluconeogenesis
psr00020  Citrate cycle (TCA cycle)
psr00620  Pyruvate metabolism
psr01100  Metabolic pathways
psr01110  Biosynthesis of secondary metabolites
psr01120  Microbial metabolism in diverse environments
psr01130  Biosynthesis of antibiotics
psr01200  Carbon metabolism
Module
psr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAA_3947 (aceF)
   00020 Citrate cycle (TCA cycle)
    PSTAA_3947 (aceF)
   00620 Pyruvate metabolism
    PSTAA_3947 (aceF)
Enzymes [BR:psr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSTAA_3947 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_D23 RnfC_N HlyD_3 CAT
Motif
Other DBs
NCBI-ProteinID: AEA85802
UniProt: F2N4Q1
Position
4231538..4233544
Genome map
AA seq 668 aa AA seqDB search
MSETIRVPDIGSGEGEVIELFVKVGDRIEADQSILTLESDKASMEIPAPKAGVVKSLKVK
LGDRLKEGDELLELESEEGQDSAAPAQAAAEPAGAATGGPTDEAEAPTPPGDDDASASAG
EGETQEIKVPDIGSSGKASVIEIAVKAGDTIAAEQALITLESDKASMEIPSPAAGVIESI
SVKVGDEVGTGDLILILKGAASSKPAAGKAPASQAASAPKQKLSEPAAEEPAEAAGESVE
EVRIPDIGSSGSANVIEVMVKAGDSVEADQSLITLESDKASMEIPAPKAGVVESLSIKVG
DEAKTGDLILTLKVQGTAPAKKPAPKADEAAPQQQAVAPNKQGVPEAKAAATPAPAVSGP
SKAGTKVHAGPAVRMLAREFGVELTDVPATGPKGRILKEDVQAYVKNMLHKVKQAPAEGT
TGGAGIPPIPTIDFSKFGEVEEVPMTRLMQVGAANLHRSWLNVPHVTQFESADITELEAF
RVAQKAIAEKAGVKLTVLPLLLKACAHLLKELPDFNSSLAPSGKALIRKKYVHVGFAVDT
PDGLMVPVIRNVDQKSLLQLAGEAAELAEKARTKKLSPDAMQGACFTISSLGHIGGTGFT
PIVNAPEVAILGVSKAAMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLSELL
ADIRTMLL
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaaccatacgcgtacccgacatcggcagtggtgagggtgaagtaatcgaattg
ttcgtcaaggtcggcgaccgtatcgaagccgaccagagcatcctgacgctcgagtccgac
aaggccagcatggaaattccagcgcccaaggcgggcgtggtgaagagcctgaaggtcaag
ctcggcgatcgtctgaaagaaggcgacgagctgctggagctggaaagcgaagaaggccag
gacagtgcggctccggcacaggctgcagccgaacccgctggcgcagcgaccggcggcccg
acagatgaagccgaagcgccgacgcctccgggcgacgacgatgcttcggcctcggccggc
gaaggcgagacacaggagatcaaggttcctgatatcggctcctcgggcaaagccagcgta
atcgagatcgcggtcaaagccggcgataccattgccgccgaacaagcgttgatcacgctc
gagtcggacaaggccagcatggagattccgtctcctgccgccggcgtgatcgagagcatt
tcggtcaaggtgggcgacgaagtcggcaccggcgatctgatcctgattctcaaaggcgca
gcgtccagcaagccagcagcaggcaaggcgccagcaagccaggccgcaagcgctccgaag
caaaagctgagcgagccggcagctgaagagcctgccgaagccgccggcgaatccgtggaa
gaagtgcgtatcccggacatcggctccagcggcagcgccaatgtcatcgaagtgatggtc
aaggccggggacagcgtcgaggcggatcagtcgctgattacccttgagtccgacaaggcc
agcatggaaattcctgcgcccaaggcgggcgtggtggaatcgctgtcgatcaaggtcggt
gacgaggccaagaccggcgatctgatcctgaccctaaaggtccaaggcaccgcaccggcg
aagaaacccgctcccaaggcggatgaggctgcgccgcagcagcaggccgtcgcaccaaac
aagcaaggcgttcccgaggcgaaggctgccgcgacgccggctccggcggtcagcggcccg
agcaaggctggcaccaaggtgcacgcggggccggcggtacgcatgcttgcacgcgaattt
ggcgtagaactgactgatgttccggccactggcccgaagggacgcatcctcaaggaagac
gtccaggcctacgtcaagaacatgctgcacaaggtcaagcaggctcctgccgaaggtact
accggcggggcgggtattccgccgatcccgacgatcgacttcagcaagttcggtgaagtc
gaagaagtgccgatgacccgcctgatgcaggtcggtgccgccaacctgcatcgcagctgg
ctgaacgtaccgcacgtgacccagttcgagtcggccgacattaccgagctggaagctttc
cgcgttgcgcagaaggcgatcgccgagaaggctggggtcaagctcaccgtgctgccgcta
ttgctcaaggcgtgcgcgcacctgctaaaggaactgccggatttcaacagttccctggcc
ccgagcggcaaggcgctgatccgcaagaagtatgtgcacgtagggttcgccgtcgacacg
ccggatggcctgatggtcccggtgattcgcaacgtcgaccagaagagtctgctgcaactg
gccggcgaggctgcggagctggctgagaaggcccgcaccaagaagctttctccggatgcg
atgcagggcgcctgcttcacgatctccagcctcggccacatcggcggcaccggcttcacg
ccgatcgtcaatgcgccggaagtggcgatcctaggcgtctccaaggcggccatgcagccg
gtgtgggatggcaaggccttccagccccgcctgatgctgccgctgtcgctctcctacgac
caccgggtgatcaacggtgccgcggcggcgcgcttcaccaagcgcctgtcggagctgctg
gccgatatccgcaccatgctgctgtaa

DBGET integrated database retrieval system