KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_4183Help
Entry
PSTAA_4183        CDS       T01976                                 

Gene name
recD-2
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:psr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4494564..4496414)
Genome map
AA seq 616 aa AA seqDB search
MTLADLPLGPLERAFVASLQRLEPQAPEAVLIAATLCCEALAAGDVCLSLERLAGRRPWP
DVDLSMPELPVWRAQLEASTLVGTPDDYAPLTLVGDRLYLARYQAYEQQLAEQLLARTGD
APEVDEARLAESLARLFAFNQQRPDWQRLAAAQAVRRRLAVISGGPGTGKTTTVVRLLAA
LLEQPGGERLAIGLAAPTGKAAARMAEAIRNAKAELPVSDAVKAALPDEARTLHRLLGSR
GDSPRVRHDAANPLALDVLVVDEASMVDLALMAKLVVALPPKARLILLGDKDQLAAVEAG
AVFAELCEGRGFDAGAASELERITGQPVPVETPRSRLGDAVVLLTHSHRFAGDSGIGELA
RRINAGDAKGTVALLQEGRADLAWNATPGATALIERLEQGYGGYLQAARQGDPGPAFEAF
NGFRALTAQREGPFGVTGINEALETRFRRRLGVPARERWYPGRAVMVRQNDYALGLFNGD
IGLCLKTEQGLRVFFEGDNGYRGFAPARLPSHDSAFAMTVHKSQGSEFTEVLLALPDQPS
PLLTRALFYTGITRAKRRVEIWALPARLAEAVSTRAERAAGLAERLVLAGAVADADAVPE
APIGAAPAEGDQLSLF
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgccgatctcccactcggcccgctggagcgcgcctttgtcgcaagtttgcag
cgcctggaaccgcaggcgcccgaagcggtgctaattgccgccacgctgtgctgtgaggcg
ctggcggccggcgatgtctgtctttcactggaacgccttgccggaaggcgcccctggccc
gatgtcgatctcagcatgccggagctgcccgtctggcgcgcacagctcgaagcttccacg
ctggtcgggacaccggacgactatgcgccgctgaccctggtcggcgaccggctctacctg
gcccgctaccaggcctacgaacagcagctggccgaacagctgctggcccgcaccggcgat
gcgcccgaggtggacgaagcacggctcgccgagagcctggcgcgcttgttcgccttcaat
cagcagcgccccgactggcagcgcctggccgccgcgcaggcagttcggcggcgcctggcg
gtgatctccggcggtcccggcaccggcaagaccaccaccgtggtgcgcctgctggcggcg
ctgctcgagcagcctggcggcgagcgcctggccatcggcctcgccgcacccaccggcaag
gccgcggcgcgcatggccgaggcgatccgtaacgccaaggccgagctgccggtcagcgat
gcggtgaaagcggcgctgccggacgaggcgcggaccctgcaccgcctgctcggcagccgc
ggcgacagcccccgcgtgcgccacgatgcggccaatccgctggcgctggacgtgctggtg
gtggacgaggcgtcgatggtcgacctggcgctgatggccaaactggtcgtcgcgctgcca
ccgaaggcgcggctgatcctgctcggcgacaaggatcagctggccgccgtggaggccggt
gcggtgttcgccgaactctgcgaaggccgtggcttcgatgccggggcggcaagcgagctg
gagcgcatcaccggccagcccgtgccggtcgagacgccgcgctcgcgcctcggcgatgcg
gtggtgctgctcacccacagtcaccgcttcgccggcgacagcggcatcggcgagctggcg
cggcggatcaacgctggcgatgcgaaaggcaccgtcgcgctgctgcaggaaggtcgtgcg
gatctcgcctggaacgcgacgcccggcgcgaccgccttgatcgagcggctggagcagggt
tacggcggctacctgcaggctgcgcggcagggcgatccaggcccggcgttcgaggccttc
aacggtttccgggcgctgactgcgcaacgcgagggcccgttcggcgtgaccggtatcaac
gaggcgctggaaacacgcttcaggcgtcgcctcggcgtgccggcccgcgaacgctggtat
cccggccgtgcggtgatggtccggcagaacgactacgcgctggggctgttcaacggcgat
atcggcctgtgcctgaaaaccgagcagggcctgcgggtgttcttcgagggtgacaacggt
taccgcggcttcgcgccggcacggctgccgagccacgacagcgccttcgccatgaccgtg
cacaagagccagggctcggaattcaccgaggtgctgctggccttgccggatcagccgagc
ccgctgctgacccgcgcgctgttctacaccggcatcacccgcgccaagcgccgggtggag
atctgggcgctgccggcacgtctggctgaagcggtcagcacccgcgccgagcgcgccgcc
ggactggccgagcggctggttctggcgggtgccgtggccgatgccgatgcggtgccggaa
gccccgatcggtgcggcgccagccgagggcgatcagctcagcctgttctaa

DBGET integrated database retrieval system