KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_4183Help
Entry
PSTAA_4183        CDS       T01976                                 

Gene name
recD-2
Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:psr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSTAA_4183 (recD-2)
Enzymes [BR:psr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PSTAA_4183 (recD-2)
DNA repair and recombination proteins [BR:psr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PSTAA_4183 (recD-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD UvrD-helicase UvrD_C AAA_22 T2SSE DUF2075 AAA_16 AAA_28 CbiA AAA_5 DUF87 Flavi_DEAD ATPase
Motif
Other DBs
NCBI-ProteinID: AEA86038
UniProt: F2N6Q5
Position
complement(4494564..4496414)
Genome map
AA seq 616 aa AA seqDB search
MTLADLPLGPLERAFVASLQRLEPQAPEAVLIAATLCCEALAAGDVCLSLERLAGRRPWP
DVDLSMPELPVWRAQLEASTLVGTPDDYAPLTLVGDRLYLARYQAYEQQLAEQLLARTGD
APEVDEARLAESLARLFAFNQQRPDWQRLAAAQAVRRRLAVISGGPGTGKTTTVVRLLAA
LLEQPGGERLAIGLAAPTGKAAARMAEAIRNAKAELPVSDAVKAALPDEARTLHRLLGSR
GDSPRVRHDAANPLALDVLVVDEASMVDLALMAKLVVALPPKARLILLGDKDQLAAVEAG
AVFAELCEGRGFDAGAASELERITGQPVPVETPRSRLGDAVVLLTHSHRFAGDSGIGELA
RRINAGDAKGTVALLQEGRADLAWNATPGATALIERLEQGYGGYLQAARQGDPGPAFEAF
NGFRALTAQREGPFGVTGINEALETRFRRRLGVPARERWYPGRAVMVRQNDYALGLFNGD
IGLCLKTEQGLRVFFEGDNGYRGFAPARLPSHDSAFAMTVHKSQGSEFTEVLLALPDQPS
PLLTRALFYTGITRAKRRVEIWALPARLAEAVSTRAERAAGLAERLVLAGAVADADAVPE
APIGAAPAEGDQLSLF
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgccgatctcccactcggcccgctggagcgcgcctttgtcgcaagtttgcag
cgcctggaaccgcaggcgcccgaagcggtgctaattgccgccacgctgtgctgtgaggcg
ctggcggccggcgatgtctgtctttcactggaacgccttgccggaaggcgcccctggccc
gatgtcgatctcagcatgccggagctgcccgtctggcgcgcacagctcgaagcttccacg
ctggtcgggacaccggacgactatgcgccgctgaccctggtcggcgaccggctctacctg
gcccgctaccaggcctacgaacagcagctggccgaacagctgctggcccgcaccggcgat
gcgcccgaggtggacgaagcacggctcgccgagagcctggcgcgcttgttcgccttcaat
cagcagcgccccgactggcagcgcctggccgccgcgcaggcagttcggcggcgcctggcg
gtgatctccggcggtcccggcaccggcaagaccaccaccgtggtgcgcctgctggcggcg
ctgctcgagcagcctggcggcgagcgcctggccatcggcctcgccgcacccaccggcaag
gccgcggcgcgcatggccgaggcgatccgtaacgccaaggccgagctgccggtcagcgat
gcggtgaaagcggcgctgccggacgaggcgcggaccctgcaccgcctgctcggcagccgc
ggcgacagcccccgcgtgcgccacgatgcggccaatccgctggcgctggacgtgctggtg
gtggacgaggcgtcgatggtcgacctggcgctgatggccaaactggtcgtcgcgctgcca
ccgaaggcgcggctgatcctgctcggcgacaaggatcagctggccgccgtggaggccggt
gcggtgttcgccgaactctgcgaaggccgtggcttcgatgccggggcggcaagcgagctg
gagcgcatcaccggccagcccgtgccggtcgagacgccgcgctcgcgcctcggcgatgcg
gtggtgctgctcacccacagtcaccgcttcgccggcgacagcggcatcggcgagctggcg
cggcggatcaacgctggcgatgcgaaaggcaccgtcgcgctgctgcaggaaggtcgtgcg
gatctcgcctggaacgcgacgcccggcgcgaccgccttgatcgagcggctggagcagggt
tacggcggctacctgcaggctgcgcggcagggcgatccaggcccggcgttcgaggccttc
aacggtttccgggcgctgactgcgcaacgcgagggcccgttcggcgtgaccggtatcaac
gaggcgctggaaacacgcttcaggcgtcgcctcggcgtgccggcccgcgaacgctggtat
cccggccgtgcggtgatggtccggcagaacgactacgcgctggggctgttcaacggcgat
atcggcctgtgcctgaaaaccgagcagggcctgcgggtgttcttcgagggtgacaacggt
taccgcggcttcgcgccggcacggctgccgagccacgacagcgccttcgccatgaccgtg
cacaagagccagggctcggaattcaccgaggtgctgctggccttgccggatcagccgagc
ccgctgctgacccgcgcgctgttctacaccggcatcacccgcgccaagcgccgggtggag
atctgggcgctgccggcacgtctggctgaagcggtcagcacccgcgccgagcgcgccgcc
ggactggccgagcggctggttctggcgggtgccgtggccgatgccgatgcggtgccggaa
gccccgatcggtgcggcgccagccgagggcgatcagctcagcctgttctaa

DBGET integrated database retrieval system