KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_4207Help
Entry
PSTAA_4207        CDS       T01976                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
psr  Pseudomonas stutzeri DSM 4166
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4530652..4532517)
Genome map
AA seq 621 aa AA seqDB search
MSEEAERWKEKYLQLAERQEQLDARWEQRVDLLRRSLVRSSLAVEGADPAVERCLQQMRE
VLRDGDLDDGLGQLVPRLEKAVLDSERHRQERAVQLTEALHRLVSQLLGMSVPAELRKPL
KRFAKDLDQRAARLRELPLLLGELSVLQGQVLNLQGLSAPQQSGFLKRLFGGRDSQSAAP
LETAIPAAASASAVAVEAEAVVVGETAVASAVTEPSVVATLPEPANEEQQAVEPVVSAVE
PEADEPVADAELPPAAEPLPQEAAYALPDSPEPAFSVVAERVEATLSSLLDSLHLPEQHQ
PQLQTLRARIQQGLNWYELVPVLDDLAMLMIAFSDQGQRDFENYLQTLNERLTAMQENLL
AAHQGHVEGRDAAQALDAELREQVGGLQHSMREATDLNSLKRVVEARLDGLLDTVDNYRR
QRSEQEQKLGERLQQLVSRVGSLEQAARGLRGHLEEQRQKALQDPLTGLPNRAAWNERLD
LEFARWQRYGGDLLLAVLDVDHFKRVNDGYGHLAGDRVLKIIGTELQKRLRKTDFIARFG
GEEFVVLLPNTPYEAGRQLMETLRESIGSCPFHFKGERVAITLSAGLTAFVIGDTAERAF
ERADRALYRAKDSGRNRVEPA
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaagccgagcgctggaaggaaaagtatcttcagctggccgagcgccaggag
cagctggacgcccgctgggagcagcgcgtcgatctgttgcggcgcagcctggtgcgcagc
agcctggcggtggagggcgccgaccccgccgtcgagcgctgcctgcagcagatgcgcgag
gtcctgcgtgacggggatctggacgatgggctgggtcagctcgttccacgcctggaaaag
gcggtgctggactccgaacgccaccgccaggagcgtgccgttcagttgaccgaggcgttg
catcggctggtgtcccagttgctggggatgtcggtgcccgccgagctgcgcaagccgctc
aaacgcttcgccaaggatctggaccagcgtgcagccagattgcgcgagctgccgctactg
ctcggcgagctgagtgtactgcagggtcaggttctcaacctgcagggtttgtccgcgccg
cagcagagcggctttctgaagcgcctgttcggggggcgggacagccaatcggcggccccg
ctcgagacggcgattccagcggcggcgtcggcctcagcggtggcggtcgaggcagaggcg
gtcgtcgtcggcgagacggccgtcgcctccgccgtgaccgagccgtccgtggtggcaacc
ttgccggagccggcgaacgaagagcagcaggccgtcgagcctgtcgtctcggcagttgag
cccgaagcggacgagccggtggcggacgccgagctgccgccagcggccgagccgctgccg
caggaggccgcctatgcgctgccggattcgccggagcccgctttcagcgttgtcgccgaa
cgtgtggaggcgacgctcagcagtctgctcgacagcctgcatctgcccgagcagcatcaa
ccgcaactgcagacgttgcgcgcgcgaatccagcagggcctgaactggtacgagctggtg
ccggtgctggacgatctggcgatgctgatgatcgccttcagcgatcagggtcagcgcgat
ttcgagaactacctgcagaccctcaacgagcgtctgactgcgatgcaggagaacctgctc
gccgcccaccagggccatgtggaaggccgcgatgcggcgcaggcgctggacgccgagctg
cgcgaacaagtcggcgggctgcagcacagcatgcgtgaagccaccgatctgaacagcctc
aagcgggtggtggaggcgcgtctggatggcctgctggacaccgtcgacaactaccgtcgc
cagcgcagcgagcaggagcagaaactgggcgagcgcctgcagcagctggtcagccgtgtc
ggcagcctggaacaggcagcacgggggctgcgcggccatctggaagagcagcggcagaag
gccctgcaggacccgctgaccggactgcccaaccgggcggcatggaatgaacggctggat
ctcgaattcgcccgctggcaacgctacggtggcgatctgctgctggccgtgctggatgtc
gatcacttcaagcgggtcaacgacggctacggccatctggccggcgatcgggtgctgaag
atcatcggcacggagctgcagaagcggttgcgcaagaccgacttcatcgcccgtttcggt
ggtgaggagttcgtcgtgctgttgcccaacacgccttacgaggcggggcggcagctgatg
gaaacgctgcgcgagtccatcggcagttgcccgttccacttcaagggcgagcgggttgcc
atcaccctgtccgccggtttgacggcattcgttattggcgacaccgccgagcgtgccttc
gagcgtgccgaccgggcgctctaccgcgccaaggattcgggacgcaatcgtgtcgagcca
gcctga

DBGET integrated database retrieval system