KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_4259Help
Entry
PSTAA_4259        CDS       T01976                                 

Definition
aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAA_4259
Enzymes [BR:psr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PSTAA_4259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4580125..4581027
Genome map
AA seq 300 aa AA seqDB search
MPVDIQRIEMNQLACWRVRRGEDELLIAEQGAQILSYRQGDAPPIIWLSEEAAFEQGQSV
RGGVPVCWPWFGDLARNPQEVQASYHGEQPAPFHGLVRALPWQLREQRGEGDTAILEFHC
PQALGALPGWPHRVELTLQIRLADELELSLSSRNVGTQAVTISQALHSYFAVSDIHQVRV
EGLAGCPYIDTLLDWQQRQQQNGDLAFNGETDRIYLQLPTTLKLIDPAWKRSIQLTTRGS
RSAVLWNPWIDKAKRLSSFADDAWQRMACIETANVLDDAVVLQPGQQHLLSVSVTAIPAR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcgatatccaacgcatcgaaatgaaccagctcgcctgctggcgagtacgccgc
ggtgaggacgaactgctgatagccgaacagggcgcgcagatcctcagctatcgccagggc
gatgcgccgccgatcatctggctcagcgaggaggccgccttcgaacagggccaatcggta
cgcggaggcgtacccgtatgctggccgtggttcggcgatctggcgcgcaacccacaagag
gtccaggcgagctaccacggcgagcaacccgcgcccttccacggcctggtgcgcgccctg
ccctggcaattgcgggagcagcgcggcgaaggcgatacggcgattctcgagttccactgc
ccgcaggcgctcggcgcactgccgggctggccgcaccgggtcgaactgacactgcagatc
cgcctggccgacgagctggagctcagcctcagcagccgcaacgttggcacgcaggcagtc
accatcagccaggccctgcacagctacttcgccgtcagcgacatccatcaggttcgcgtc
gaaggcctggccggctgcccctacatcgatacgctgctggattggcagcagcgccagcag
cagaacggagacctggcgttcaacggcgaaaccgaccgcatctacttgcagctcccgacg
accctgaagctcatcgacccggcatggaaacgcagcatccagctgaccacccgcggctcg
cgatcagcggtgctgtggaacccctggatcgacaaggccaagcgcctgtccagcttcgcc
gacgacgcctggcagcgcatggcctgcatcgagacagccaacgtgctggacgacgccgtg
gtcttgcagccgggccagcagcacctgttgagcgtatccgtcaccgcaatccccgcgcgc
tga

DBGET integrated database retrieval system