KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102444504Help
Entry
102444504         CDS       T02980                                 

Gene name
CLOCK
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    102444504 (CLOCK)
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102444504 (CLOCK)
Transcription factors [BR:pss03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102444504 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
ENSPSIG00000011404
UniProt: 
Position
Un
AA seq 851 aa AA seqDB search
MFFTIRTHKMSTITDRDDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNTRKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTPLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TQEYLKSKNQLEFCCHMLRGTIDPKEPPTYEYVRFIGNFKSLNNVSSSAHNGYEGTIQRS
HRPSYEDRICFVTTVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPEIAANKSQDSGSDNHINTVSLKEA
LERFDHSGTPSASSRSSRKSSHTAVSDPSSATPTKMTIDTNTPPRQNLSGHEKTAPRRSS
LSSQSLNAQSVGQPLAQPMISQPATLQIQPGMPQPMFQFSAQLGAMQHLKDQLEQRTRMI
EANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSTPGINFGSVQLTSGNSSSIQQLAPINM
QGQVVQANQIQGGMNTGHISTQHMIQQQPLQSTATQHTQQNLLSGHNQQTSLTNQSQNTL
SAPLYNTMVISQPTTGNVLQIPSSLPQNNNQSAAVTTFTQDRQIRFSQGQQLVTKLVTAP
VACGAVMVPSTMFMGQVVTAYPTFAAQQQQTQTLSMTQQQQQSQQEQQQQLSTVQQSSQA
QLAQHPQQFLQTSRILHGNQSTQLILSAAFPLQQSTFTQSHHQQHQSQQQQQQLSRHRTD
NITDPSKVQPQ
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgttctttaccataaggacccataaaatgagcaccattacagacagagatgatggtagt
atttttgatgggctggtggaggaagatgacaaggataaagctaaaagggtgtctagaaac
aagtctgaaaagaaacgtagagatcagtttaatgttctcatcaaagagcttggttccatg
cttccgggtaatactcggaagatggataaatccactgtattgcagaaaagcattgacttt
ttacggaagcacaaagaaatcactgcacagtcagatgccagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagttcacacagttaatgttggaggctcttgatggc
ttttttttagcaatcatgacagatggaagtataatatatgtgtctgaaagtgtaactccc
ttacttgaacatttgccatctgatcttgtggatcagagtatatttaattttatcccagag
ggggaacattcagaggtttataaaatactgtctactcatcttctggaaagtgattcattg
acccaagaatatttaaaatcaaaaaatcaactagaattttgttgccatatgctgcgagga
acaatagacccaaaagaaccacctacatatgaatatgtaaggtttataggaaatttcaag
tctttgaataatgtctccagctccgcacacaacggatatgaaggaactatccagcggtcc
catcggccttcctatgaagacagaatttgctttgtcactacagttaggttagctacacct
cagtttatcaaggaaatgtgcactgttgaagaacccaatgaagaattcacatctagacat
agtttagaatggaagttcctattcttggatcacagggcacctccaataataggctattta
ccatttgaagttctggggacatcgggctacgattactatcacgtagatgacctagaaaat
ctggcaaaatgtcatgaacacttaatgcaatatggaaaagggaagtcatgttattacagg
ttcctgacaaaggggcagcagtggatttggctacaaacacattactatattacttatcat
cagtggaattccaggccagagtttattgtctgtacacatactgtagtaagttatgcagaa
gttcgagcagaaagacgaagagaacttggtattgaagagtctcttccagagatagcagca
aataaaagtcaggactctgggtctgataatcatataaacacggtcagcctcaaagaagct
ttggaaagatttgatcacagcggtacaccttcagcttcctccaggagttcaaggaaatca
tcgcatactgcagtctcagatccttcatcagcaacgccgacaaaaatgacaatagacact
aacactcctccaagacaaaacttatctggtcatgaaaagactgcaccaaggaggtcatcg
cttagtagtcagtccttaaacgcccaatctgttggacaaccattagcacagccaatgata
tctcagcctgcaactttacagatccagccaggcatgccccagcctatgtttcagttttca
gcccaattgggagccatgcagcacctaaaggaccagttggagcaaagaacacgaatgata
gaggcaaatattcatcggcagcaagaagagttgcgtaagattcaagaacagcttcaaatg
gtccatggtcaagggcttcagatgtttttgcagcaatcaactcctggaataaactttggt
tctgtgcaacttacttctggaaattcttctagcattcagcagcttgcaccaataaacatg
caaggtcaagttgttcaggctaatcaaattcaaggtggtatgaacactgggcatattagt
actcagcacatgatacagcagcagcctttgcagagtacagcaacacagcatacacagcaa
aatctacttagtggacacaatcaacagacttctcttaccaatcaatcacagaatacactt
tctgcccccttgtataacactatggtgatttcccagccaacaacaggaaatgtgctccag
attccatctagtttaccacaaaacaataaccagagtgctgcagtaactactttcacccag
gacagacagatcaggttttctcaaggtcagcagcttgtcacaaaattagtcactgcccct
gtagcatgtggagcggtaatggttccaagcactatgtttatgggacaggtggtgaccgcc
taccccacttttgctgcacaacagcagcagacacagacattatcaatgacacagcagcag
caacagagtcagcaagagcaacaacagcagctcagtacagttcagcagtcgtctcaagct
cagctggcacagcatccgcagcagttcttacagacatccaggatacttcatggaaatcaa
tccactcaacttattctctctgctgctttcccactacaacaaagcacttttactcaatca
caccaccagcagcatcaatctcagcagcagcagcaacaactctcacgacatagaactgac
aacataactgatccttccaaagttcagccacaatag

DBGET integrated database retrieval system