KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102446471Help
Entry
102446471         CDS       T02980                                 

Definition
protein-glutamine gamma-glutamyltransferase E-like
Orthology
K05620  
transglutaminase 3 [EC:2.3.2.13]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102446471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 690 aa AA seqDB search
MADLKLTNINWQLEANGSAHHTDEYASKELIVRRGQPFSIMLNYNRTLKPEESLTFTAET
GPKPSLQAKTQAVFSISSTASNGTWSAVQQSTESSSVTISIYCPANAAIGRYKLSVQPTS
ASRTPVGTFVLLYNPWSQGDDVFMPNNAERQEYVMEEFGMVFTGNANRINSSGWNYGQFQ
KGILDICLASLDKSLNYRRDPATDVSRRNDPKYVGRVLSAMINSNDDNGVVMGNWSGNYS
GGASPSSWNGSVEILRKWKAAGFKPVKYGQCWVFASVLTTVLRCLGIPTRMISNFNSAHD
TDKNLSVDEYYDESGNPLRMGGDSVWNFHVWNESWFTRKDLGSSYNGWQILDATPQERSA
GIFQCGPASLTAIKEGDVDLDYDAPFIFAEVNADRITWRYNPTTRETKPISSDTMSIGKF
TSTKAVGSYARVDVTNDYKYEEGSQKEREVYQKARTKLGRVYGFAATAERHPEFDQKPDI
SGTFKVDGALEIGKDVRLSLVLRNLTSEAKDIKANMTAWSIVYTRKPIHEVWKDSLSATL
ASEEEKRFPIKIAYAEYQQHLTSDNMLRVTALCQVEGGIEVVVERNIVLENPQLVMQVVG
DAKVNEPVNVEVIFTNPLDQEVKDCTLQAEGSDLLKEKLKIEMPPLKPKQSSKVPFEIFP
TKTGTKQLLVNFSSDKFPDVKAFETINVAN
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggctgatttaaaattgacaaatatcaactggcagctagaagcaaatgggagcgcacac
cataccgatgaatacgccagcaaagaactcattgtgaggagaggacagcccttctccatc
atgctgaactacaacagaacactgaagcctgaagagagcttaacattcactgcagaaaca
ggaccaaaaccatcactgcaagctaagacccaggctgtattcagcatctccagcacagca
agcaatggtacctggagcgcagtccaacaatccaccgagtccagctccgtcaccatctct
atttactgtccagccaatgctgccatcggacgctacaaactgagcgtgcagcctacctca
gcctcccgtacacctgtcggaacttttgttctactctataacccctggtctcaaggagat
gatgtgtttatgcctaacaatgctgaacgccaagagtacgtgatggaagagtttgggatg
gtttttacaggcaacgcaaaccgcattaacagttctggttggaactatggccagtttcaa
aaaggcattctggatatttgcctcgcctcgctggataaaagcctaaactaccgtagagac
cctgccaccgatgtgtctcgcagaaatgatcccaagtacgtgggccgtgtgctcagtgcc
atgatcaacagtaatgatgataatggggtagtgatgggaaactggagtggaaattacagt
ggtggagcaagtcccagcagttggaacggaagcgttgaaatcctgagaaagtggaaggct
gcgggatttaaacctgtcaaatacggacaatgctgggtttttgcatcagtgctgaccaca
gtgctcagatgtctggggattcctactcgcatgatttcaaatttcaactctgcccacgat
acagataaaaacctgagtgtggatgaatattatgatgaatctggaaatcctctgagaatg
ggaggtgacagcgtctggaatttccatgtctggaatgaaagctggtttacccgaaaggac
ctcggatcctcctacaacggatggcaaattctggatgcgaccccccaggagagaagcgca
ggaatattccagtgtggtcctgcctcacttacggccatcaaagaaggagatgtagacctg
gactatgacgctccatttatatttgctgaggtgaatgcagaccggatcacctggagatac
aaccccacaactagagagacaaagcctatctcctctgacaccatgtcaattggcaagttc
accagcaccaaggcagtaggcagttacgcccgtgtagatgtcactaatgattacaaatat
gaagaaggctctcagaaggaaagagaggtgtatcaaaaggctcgcacaaaactgggccga
gtatatggttttgctgccacagcagagaggcatccagaatttgatcaaaagcctgatatc
tcagggacattcaaggtagatggagccttagagattggcaaagatgtcagactaagcttg
gttctcagaaatttgacctcagaggctaaagatataaaggcaaatatgactgcttggagc
atcgtgtacaccaggaagccaattcatgaggtgtggaaggactccttatcagctactctt
gcttctgaagaagagaaacggtttcccattaagatcgcgtatgccgagtaccagcaacat
ttaactagcgacaacatgctgcgagtgactgctctgtgtcaagtagaaggtgggattgaa
gtggtggtggaaaggaacattgttctggagaaccctcagcttgtcatgcaggtggtcggt
gatgccaaggtgaatgaaccagtgaatgtggaagtgatatttaccaatcctctcgaccaa
gaggtgaaagactgcaccctgcaggcagaaggcagcgacctgctcaaagaaaagctcaag
atagaaatgcccccactaaagcccaagcagagctccaaagtgccgtttgagatctttccc
accaagactggaaccaagcagctgctcgttaatttctccagtgacaagtttccggatgtc
aaagcctttgagaccataaatgtggccaactga

DBGET integrated database retrieval system