KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102447904Help
Entry
102447904         CDS       T02980                                 

Gene name
TGM4
Definition
transglutaminase 4
Orthology
K05621  
transglutaminase 4 [EC:2.3.2.13]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102447904 (TGM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 694 aa AA seqDB search
MSQTAASSLKTLGVDLLQKQNVPLHHTEEYYDNATLIVRRGQVFQLKLTFDRGLKDDDKV
VLQLSIGEKPMESNETLVLMNLRAGRDSRCWCANILNTNGKECLVTVTSPADAAVGKYFL
SVKTGPHVYNPGNKVVYVLFNPWCEADTVFMRNDAERSEYVLSDTGYIYVGSEQNIFGRP
WNFGQFEEDVLDCCMYLLEKSKLKQKVRKDPVIVSRAMSALVNSNDDAGVLFGNWSGSYS
GGTSPLAWTGSAPILQKYYKTKRSICFGQCWVFSGVLTTVMRCLGIPARSVTNFASAHDT
EENLKVDIYLNEKGEKLDKMTSDSVWNFHVWNDVWMKRPDLPQGFDGWQAVDATPQEISQ
GIFQCGPCPLKAIKSGEVYLLYDSKFLFAEVNADRVFWLVKNLNDKQKLVKLREETKAIG
KSISTKAVGKNTREDITEQYKFPEGSPEERKAVEKACSYLNSSNLSVCESTPRLPPLQAQ
LQLEVEGEKALWLGNPINLNIIVRNSSVGAWTVNLTASCQLQTYTGKVEANLGFIKQTVQ
TEGKPVIQLPLNIAADSYVKTTTAVEDELLIKVNIIAEILETSEKLTDVITLMFQYPPIK
VEMPETAKINEDFTCSFLFKNTLTVPLEKCKLYVEGLGIFKMETIDQGDIMPGRITKSQI
ICAPNKTGEKKIVAKLTSNQVKAISVEKMITITA
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagacagctgccagcagcctgaagacccttggagttgatttactccaaaagcaa
aatgtcccccttcaccacactgaggagtattatgacaatgccacgctgattgtgcgacga
gggcaggtgtttcagttaaagctgaccttcgaccgggggctgaaagatgatgacaaagtg
gtgttgcagctcagtattggtgagaaaccaatggaatccaatgagacccttgtgttgatg
aatctgagggctggacgggactcccggtgctggtgtgccaacattttgaacaccaatggg
aaggagtgcctggtaactgtgaccagtccagcagatgcagctgttggaaaatactttctg
agtgtgaaaactgggcctcacgtttataaccctggaaacaaagtggtctacgtattgttc
aacccgtggtgtgaagctgacacagttttcatgcgtaatgatgccgaaagatcagaatat
gttctcagtgacacgggctacatctacgttggatcagagcaaaatatatttggaagacct
tggaattttggacagtttgaggaggatgtcttggactgctgtatgtatctcctggagaaa
agtaaactcaagcaaaaagttagaaaagaccctgtgattgtgtccagagccatgtctgct
ttagttaattccaatgatgacgcaggagttctttttgggaactggtcaggatcctatagt
ggtggaacttcccccctggcctggacaggaagtgctccaattttgcagaaatactacaaa
acaaaaagatccatctgttttggtcagtgctgggttttctctggagttcttactacagtt
atgcgctgcctggggattccagccagaagcgtgactaacttcgcctcagctcacgatact
gaggaaaacctgaaagttgacatatacctgaatgaaaaaggcgaaaaactggataaaatg
acatcagattctgtttggaattttcacgtgtggaatgatgtgtggatgaaaaggccagac
ttgccccagggttttgatggttggcaggcagttgatgccaccccacaggagataagtcaa
ggcattttccagtgcggcccttgtccgctaaaagccatcaaaagtggagaagtctatttg
ctctatgactccaagtttttgtttgctgaagtgaatgccgacagagttttctggctggtg
aagaatctaaatgacaaacagaaacttgtcaaactgcgtgaggagaccaaggccattggg
aagagcatcagcaccaaagcggttgggaagaacacgagggaagacattacggagcagtac
aagttcccagaaggctctccagaagaacggaaagctgtggaaaaggcttgctcctacctg
aactcttcaaatttatcagtttgtgagagcacacctcgtctaccacccctacaagctcag
ctccaactggaggtagagggtgaaaaagctttgtggctcggtaatccaattaatttgaac
atcattgtacgcaacagttctgttggtgcatggacagtcaatctcactgcttcttgccaa
ctgcagacctacactgggaaagtagaagccaatcttggattcatcaaacagactgtccag
acagaaggcaaacctgttatccagctccctctgaatatagcagctgactcttatgtaaag
actacaacagctgttgaggatgaacttctcataaaagtcaatattattgctgagattttg
gaaactagtgaaaagctcactgatgtgataacactaatgttccaatatcctcctatcaag
gtggagatgccagaaactgcaaaaattaatgaagattttacatgctcctttctctttaaa
aataccttgactgttcccttggaaaagtgcaaattgtatgtagaaggactgggcattttt
aagatggaaacaattgatcaaggggacataatgcctggtaggatcactaaatcccaaata
atatgtgcgccaaataaaaccggagagaaaaaaattgtagccaaactgacctctaaccaa
gtcaaggccatatctgtggaaaagatgattaccattaccgcctag

DBGET integrated database retrieval system