KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102447947Help
Entry
102447947         CDS       T02980                                 

Gene name
CREBBP
Definition
CREB binding protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    102447947 (CREBBP)
   04330 Notch signaling pathway
    102447947 (CREBBP)
   04350 TGF-beta signaling pathway
    102447947 (CREBBP)
   04630 Jak-STAT signaling pathway
    102447947 (CREBBP)
   04068 FoxO signaling pathway
    102447947 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102447947 (CREBBP)
  Cellular commiunity
   04520 Adherens junction
    102447947 (CREBBP)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    102447947 (CREBBP)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    102447947 (CREBBP)
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102447947 (CREBBP)
Transcription factors [BR:pss03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    102447947 (CREBBP)
Mitochondrial biogenesis [BR:pss03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102447947 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
ENSPSIG00000008404
Position
Un
AA seq 2432 aa AA seqDB search
MAENLLDGPPNPKRAKLNSPGFSASDSTDFGSLFDLENDLPDELIPNGELSLLNSSGNLV
PDAASKHKQLSELLRGGSSSTLNPGIGNVNSNSPVQQGVGSQVQGQPNSANISNLGAMGK
SPLNQGDSSASGLAKQAASTSGPTTPASQALNSQAQKQVGMVTSSPATSQTGPGICMNAN
FSQTHQGLLNSNSGHNLMNQPQQGQGQVMNGSLGAAGRGRGEGMNAGSVLAETLTQVSPQ
MAGHTGLNAAQTGAMTKMGMTGNTSPFGQPFSQAGGQQMGATGVNPQLPSKPGMTNNLPP
FPTDIKSTSVTSVPNMSQMQTQVQQVGIVPTQAMTAGPTADPEKRKLIQQQLVLLLHAHK
CQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHD
CPVCLPLKNASDKRNQQPLLGSPAGGIQNSIGSVGTGQQNTPSLSNPNPIDPSSMQRAYA
ALGLPYGNQPQTQLQPQVQGQQPAQPQTHQQMRTINPLGANQMNLSAGGITTDQQASLIS
ETALPTSLGTANPLMNDGTNSGNVGNLSSLPTAAPPSSTGIRKAWHEHVTQDLRNHLVHK
LVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANSRDEYYHLLAEKIYKIQKELEE
KRRSRLHKQGILGNQPALQTPGAQPPGIPQVAAAMGQAQPVRPPNGPMSMPNVPMSRMQV
SQGMNQFNPMSVGNVQMPQAPMGPRAASPMNHPVQMNNMSSVPAMAMSPSRMPQPQNMMG
AHSSTMMGQAPTQNQFLPQNQFPSSSGAMNVNSVGMGQSTTQTGVSQQGQVPSAAIPNSM
NMLGPQSGHISCPPATQPPLHQTAPPVSTAAGKPPIQHQTPPGMTPPQPAAPTQPSTPVS
SSGQTQTPTPTPGSVPNATQTQSTPTGQTAAQAQVIPQPQTPVQPQSVPTPQPSQQQPTS
VQAQPPGTPLSQAAASIDNRVPTPGSVASADINSQQLGPDAPMLESKPEVKNEEIEPEPC
ETQVEPKPELEEDLQGSGQVKEEIDVPEAKQEPMEVEEKKLDIKVEPKEEEESGTNGTTS
QSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNP
MDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCTKLAEVFEQEIDPV
MQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLG
DDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL
KKTGRTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVK
PGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYIS
YLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQK
IPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEES
IKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPN
VSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLAR
DKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINC
YNTKSHDHKMVKWGLGLDDESNSQGEQQSKSPQESRRLSIQRCIQSLVHACQCRNANCSL
PSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQ
QQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSATPGTPTQQPSTPQTPQPPPQPQPS
PVSMSPAGFPSAPRTQPPPTVPAGKPTTQVSAPPPPAQPPPALQNEREAAQQQQQLYRVN
TINNGLPPGRPGIVNPAVGSVNQMQQVGMNVPRPNPVSGPVMTNMQPGQWQSTPXGMPRP
VMPMPPQQTVAGPRMQGVQQPPRSIAPNALQDLLRTLKSPSSPQQQQQVLNILKSNPQLM
AAFIKQRTAKYVANQPGMQPQAGIQPQPGMQQSQPGMQQPGMHTQPSLQTINAMQAGVQR
PSVPPQQQGIGGMNPQGQAINIMNPGHNPGMANMSPQYREILRRQLLQQQQQQQQQQRAA
GLAXXXXGPGGYPQAMQQQRMQQHLSIQGGSMGQMAQMGQLNQMGQPGLGADGTSNIQQA
LQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQ
SPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHLGNPEQSAMLP
QLNPPNRSALSSDLSLVGDTTGDTLEKFVEGL
NT seq 7299 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaacttactggacgggccgcccaaccccaagcgagccaagctcaactcgccg
ggcttctccgccagcgacagcacagattttggatctctgtttgacctggaaaatgatctt
cctgatgagctgatccccaatggagagttaagcctcttaaacagcagtgggaatcttgtt
ccagatgcagcttccaaacacaaacaactttctgaacttctgaggggaggcagtagctct
actttaaatcctggaattggaaatgtgaactccaatagccctgtccagcaaggagttggt
agtcaagtccaagggcagccgaacagtgcaaatatcagtaatctgggtgctatgggtaag
agccctttgaaccagggagactcttctgcttcaggcctggcaaagcaggcagccagcacc
tccggacctaccacccctgcatcgcaagcactgaactctcaagcacaaaagcaagtgggg
atggtgacaagcagccctgcaacatcacagactggacctgggatatgtatgaatgctaat
ttcagtcagacccaccagggccttctcaacagtaactctggacacaatttaatgaatcag
cctcagcaaggacaaggacaggtaatgaatggatctcttggggcagctggaagaggaagg
ggagaaggaatgaacgctggcagtgtgctggcagagactttaacccaagtatcaccacag
atggctggtcacacaggcctgaatgcagcacagacaggagcaatgacaaaaatgggaatg
acaggtaacactagtccctttgggcagccctttagtcaagctggggggcagcagatgggt
gccaccggtgtgaatcctcagttaccaagcaagccaggcatgacaaataatttgcctccc
tttcctactgacatcaagagtacttcggttaccagtgtgccaaatatgtcacagatgcaa
acccaggtacagcaggtgggaattgtaccaacacaggcaatgacagctggaccaacagca
gatcctgagaaacgcaaactgatacagcaacaactggttctactgcttcatgcccacaaa
tgtcagagacgcgagcaagcaaatggagaggtgcgagcctgtgctctcccacactgtcga
accatgaaaaacgtcctcaatcacatgacacattgtcaagctgggaaagcctgtcaagtt
gctcattgtgcatcttcacgacaaatcatctctcactggaagaactgtactcggcatgat
tgtcctgtgtgcctccctttgaaaaatgccagtgacaaaagaaaccaacagccccttcta
gggtctccagctggtggaatccagaattcaattggctctgttggaacaggccagcagaat
actccttcattaagcaaccctaatccgattgaccccagctccatgcaacgagcctatgct
gctcttggactgccatatggcaaccagccacagacacagttgcagccacaggtacaaggc
caacaaccagcacagcctcaaactcaccagcaaatgaggaccataaatccattaggagct
aaccagatgaacctttctgcaggagggataacaacagaccagcaagctagtctaatctca
gaaactgctcttccaacatccctggggacagcaaatccactaatgaatgatggcacaaat
tctggcaatgtggggaacctgagctcgttgccaacagctgcacctccttccagtacaggg
ataaggaaagcatggcatgaacacgtcactcaagacctacgcaatcacttagtccataaa
cttgtgcaagccatctttcctactcctgacccagcagcactgaaggatcgtcgcatggag
aatttggtggcttatgccaggaaagtggaaggagatatgtatgaatctgccaacagtagg
gatgaatactatcatttattagcagagaaaatctacaagatacaaaaggaactagaagag
aaacggagatctcgtttacataagcaagggatcttgggtaaccagccagccttacagacc
ccaggagctcagccacctggtatcccacaggtggctgctgccatgggtcaggcacagcct
gtgagacctcccaatgggcctatgtcgatgccaaacgtgcctatgagtcgtatgcaggtc
tctcaaggaatgaatcagtttaaccccatgtccgtagggaatgtacagatgccacaggca
cctatgggaccccgtgcagcttctccaatgaaccatcctgtacaaatgaacaacatgagc
tctgttccagcgatggcaatgtctccttcccgaatgcctcagccgcaaaacatgatggga
gcacattccagtactatgatgggtcaagctcctacccaaaaccagttcctccctcagaat
cagttcccctcatcaagtggggctatgaatgtgaacagtgttggcatgggtcaatcaaca
acccagacgggagtttcacagcaagggcaggttcccagtgctgctattccgaactccatg
aatatgctaggaccacagagtggtcatatatcatgtccaccagcgacccagccgcctcta
catcagactgcacctcctgtatccacggcagctggcaagccacctatccaacaccaaacg
ccacctggaatgactcctcctcagccagcagcacccactcagccatccacacccgtctca
tcttcaggtcagacacagacacctacgccaacacctggctctgttccaaatgcaacacag
acacaaagtacgcctacaggacaaactgcagcccaggctcaagttataccccagcctcag
actccagtacaaccccagtctgtgccaacaccacaaccatctcagcagcaaccaacatct
gtgcaggcacaacctcctggcactccactctctcaggcagcagctagtattgataaccga
gtgcccaccccaggctcagttgctagtgccgacatcaactcccagcaactgggacctgat
gcaccaatgctagaaagcaaaccagaggttaaaaatgaagaaattgagccagagccttgt
gaaacacaagtggaacctaagcctgagctggaggaggatttacaaggatctggccaagtg
aaagaagaaatagatgtgccggaggcaaaacaggagccgatggaagtagaagaaaagaaa
cttgacatcaaggtagaacctaaagaggaagaggagagtggcactaatggcaccacttca
caatctacatcaccgtctcagccgcgtaaaaaaatctttaagcctgaggagctgcgccag
gctctcatgcctaccctggaagcattgtaccggcaggacccagagtccctacctttcaga
cagcctgtggatcctcagctcctagggattccagattactttgatattgtgaagaatcct
atggacctttccaccattaaacgtaaattggatactgggcagtaccaagaaccgtggcag
tatgtggacgatgtttggctaatgtttaacaatgcctggctttacaatcggaagacttcc
agggtctataagttttgcactaaacttgcagaggtctttgaacaagagattgaccctgtt
atgcagtcacttggatactgttgtggacgcaagtatgagttttctccgcagaccttgtgc
tgctacgggaagcagctgtgtactattccccgtgatgctgcctattacagttaccagaat
aggtatcacttctgtgagaagtgtttcactgaaatccagggggagaatgttaccctgggt
gatgacccttcacagcctcaaaccacaatctcaaaagatcagtttgaaaagaagaaaaat
gatacactagatccagagccctttgttgattgcaaagaatgtggtcggaagatgcaccag
atttgtgtgctacattatgatattatttggccttcaggctttgtctgtgacaattgtctg
aagaaaactggcagaacacgtaaagagaacaaattcagcgctaaaaggctacaaactact
cgtttaggaaatcatttggaagatagagtaaacaagtttctccggcgacagaatcatccg
gaagctggggaggtctttgtcagagtggtagccagttcagataagacagtagaagtaaaa
ccaggaatgaaatccaggtttgtagattctggtgaaatgtcagaatccttcccttaccga
accaaagctctgtttgcttttgaggagatagatggagtggatgtgtgcttctttggcatg
catgtacaggagtatggctctgactgcccacctccaaataccaggcgtgtgtacatatca
tatctggatagtattcattttttccgaccccgctgcctccgaactgccgtttatcatgaa
atccttattggatatttggagtatgtgaagaaacttgggtatgtgacaggtcacatttgg
gcctgtccgccaagtgaaggagatgactatattttccattgccatccccctgatcagaaa
ataccaaaacccaaacgcctgcaggagtggtacaagaagatgttagacaaggcttttgct
gagaggatcattcacgactacaaggacatcttcaaacaagcaactgaggaccggctgaca
agtgccaaggagctaccttactttgaaggtgatttctggccaaatgtgctagaagagagc
attaaggagctagaacaggaagaggaggaacggaagaaggaagaaagtacagcagctagt
gaaacaacagaggggagccagggtgacagcaagaatgccaagaaaaagaacaacaaaaaa
accaacaagaataagagcagcatcagcagagctaacaaaaagaaacccagcatgccaaat
gtgtccaatgatctgtctcagaaactgtatgccaccatggagaagcataaagaggtcttt
tttgtgattcacttacatgctggacctgtaataaacaccctgcctcccattgtggaccct
gatccgttacttagctgtgatttgatggacgggcgagatgccttccttactttagcaaga
gataagcactgggagttctcctccttacgccgatccaagtggtccacactgtgcatgctc
gtagaattacatacgcaagggcaggaccgttttgtctatacgtgcaatgagtgcaagcac
catgtggaaacaaggtggcattgtactgtctgtgaggattacgacctttgcattaactgc
tacaacactaagagccatgaccacaagatggttaaatggggcctgggcctggatgatgaa
agcaacagccaaggagagcaacagtcaaagagcccccaggaatcacgtcgactcagcatc
caacgctgcatccagtccctggtccacgcctgtcagtgccgcaatgcaaattgctcatta
ccgtcctgccagaaaatgaaacgggttgtgcagcacaccaagggctgcaagcgcaaaaca
aatggtggctgtcctgtgtgcaaacagctcattgctctttgttgctaccatgccaaacac
tgccaagaaaacaaatgccctgtgccattctgtctcaatattaaacacaagctccggcag
cagcagattcagcaccgcctccagcaggctcagttaatgcgccgaaggatggctactatg
aacacccgaaacgtgcctcagcaaagtttgccttctcctacctcagcaacgcctggtact
cccacgcagcagccaagtactccacagacaccacagccgccgcctcagccccaaccctcc
cctgtaagtatgtcaccagctggcttccccagtgcaccaagaactcaaccccctccaact
gttccagcaggcaaacctacaacccaggtgtcagcacctccgcctcctgcccagcctccc
ccagctctgcagaatgagagagaagctgcccagcagcagcagcaactctacagggtcaac
accataaataatggtttgcctcctgggcgtccaggaatagtaaacccagcagtgggttca
gtgaaccagatgcagcaggttggcatgaatgtaccccggcctaaccctgtaagtggtcca
gtaatgaccaacatgcaacctggacagtggcagtcaactccannaggaatgccaagaccg
gtgatgccgatgccaccgcagcaaactgtcgctgggccaagaatgcaaggtgtgcaacag
ccaccacgcagcattgctccaaatgcacttcaggacttgttgcggaccttgaaatcccct
agctctccacagcagcaacagcaggttcttaatatcctcaaatccaacccacagctcatg
gcagcttttataaagcaaagaacagccaaatacgtggcaaaccagcctgggatgcaacca
caagcaggcatccagcctcagcctgggatgcaacagtctcagcctgggatgcagcagcca
ggtatgcacacacagcctagcttgcagactataaatgcaatgcaagcgggggtccagaga
ccgagtgttcctcctcagcagcagggaataggtggcatgaacccccagggacaagcgata
aacattatgaaccctggtcacaatcctggcatggcaaatatgagtccgcagtaccgagag
atactgaggaggcagttactgcagcagcagcagcagcaacaacaacaacaaagagctgct
ggcctggcannnnnnnnnnnnggacctggaggttatcctcaagccatgcaacagcaacga
atgcagcagcatctatcaatacaaggggggtccatgggacagatggctcagatgggacag
ctgaatcagatgggacagcctggcctgggggcagatggcacctccaacattcagcaagca
ctgcagcaaagaattctgcaacagcaacagatgaaacagcagatagggtccccaggccag
cctaatcccatgagcccacagcagcatatgctctcaggacaaccacaggcatctcatctc
cccggccagcagatcgccacatccctcagcaaccaggtgcgttctcctgcacctgttcaa
tctccccggccccaatcccagccaccacattccagcccgtcacccaggatacagcctcaa
ccttcacctcatcatgtatcgccccagactggttccccccaccccggacttgcagttact
atggctagctccatggatcagggacacttgggcaacccagaacagagtgccatgcttccg
cagttaaaccccccaaacaggagtgcattgtctagcgacttgtctctggttggtgatacc
acaggagacaccctagaaaaatttgtggagggtttgtag

DBGET integrated database retrieval system