KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102448076Help
Entry
102448076         CDS       T02980                                 

Gene name
KAT2B
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102448076 (KAT2B)
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102448076 (KAT2B)
Transcription machinery [BR:pss03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102448076 (KAT2B)
Chromosome [BR:pss03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102448076 (KAT2B)
   HAT complexes
    PCAF complex
     102448076 (KAT2B)
    STAGA complex
     102448076 (KAT2B)
    TFTC complex
     102448076 (KAT2B)
    SAGA complex
     102448076 (KAT2B)
    SLIK complex
     102448076 (KAT2B)
    ADA-HAT complex
     102448076 (KAT2B)
    HAT-A2 complex
     102448076 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 732 aa AA seqDB search
MCSGMLRVLWKKAEESCKCNGWKNPNPPPTPPRADLQQTIVSLADPCRSCSHALAAHVSH
LENVSEEEMNRLLGIVLDVEYLFACIHKEEDADTKQVYFSLFKLLRKCILQMGKPVVEGS
LESPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLETPLQRRLRS
PNDDFAGYKVNYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQE
KDKLPQEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFMVSSSRTGQLGIQTVISPPSV
ARSVSYSASPSTLEQPNSGNMSPACKVSSCHDPTLGEKRKNTEPYSQEDSKKPRIVGDIP
IELINEVMSTITDPAAMLGPETNLLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKK
IMMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTE
IVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILNFLTYADEYAIGYFKKQGFSKDIKVPK
AKYVGYIKDYEGATLMGCEFXIIKKKKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPI
ESIPGIRETGWKPSGKERGKEPKDPDQLYSTLKTILQQVKSHQSAWPFMEPVKRTEAPGY
YEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCREYNPPESEYYKCANILEKFF
YTKIKEAGLIDK
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcaggaatgttaagagtcctttggaaaaaggctgaggaatcttgcaaatgtaat
ggctggaaaaaccctaacccacctcctactcctcccagggcagatttgcagcagacaatt
gtcagtcttgccgacccatgtcgcagctgtagtcatgcactagctgctcatgtctctcac
ctggagaatgtttctgaggaagaaatgaataggctactggggatagtgttggatgtggaa
tatctcttcgcctgtatccacaaagaagaagatgcagatacaaagcaagtttacttctcc
ctgttcaagcttttgaggaaatgcatcttacagatggggaaacctgtggtagaggggtct
ttggaaagccccccattcgagaagcccagtattgaacagggagtgaataattttgtacaa
tacaaatttagtcatctaccatcaaaggaaaggcaaacaatagttgaactagctaaaatg
tttttaaaccgcatcaactactggcatttggagacacctttgcagcgaagattgagatcc
cctaatgatgactttgctggctataaagtgaactatacaaggtggctgtgttactgcaat
gttccccagttctgtgatagtctacctcggtacgaaaccacacaggtttttgggagaact
ctgctacgctctgtctttactgttatgagacggcaactcctggagcaggctagacaggaa
aaagacaagcttcctcaagagaaacgaacactaatcctcacccattttccaaagtttctt
tccatgctagaggaagaggtgtatagtcagaattctcctatttgggatcaggatttcatg
gtgtcctcttctcgaactggccagctaggaatccaaacagttatcagtcctccctctgtg
gcaaggtctgtttcatacagtgcaagtccttcaactctagaacaacccaacagtggaaat
atgagtcctgcttgcaaagtttcttcttgccatgacccaactctaggagaaaagagaaag
aacactgaaccttattctcaggaagattcaaaaaagcccagaattgtaggagatattcct
attgaattgatcaatgaagtgatgtctacaattacagatccagctgcaatgctagggcca
gagactaaccttctgtcagcacattcagctcgggatgaagcagcaagattagaggagcgc
cggggagtgattgaatttcatgtagttggaaattctctgaaccagaaaccaaacaaaaag
attatgatgtggctggttggcttacagaatgtattctcccatcagctacccagaatgcca
aaggagtacattacacggctggtctttgatccaaaacacaagacccttgcattaataaaa
gatggtcgtgtgattggtggtatctgtttccggatgttcccatctcaaggatttacagag
attgttttctgtgctgtgacttctaatgaacaagtcaagggttatggaactcacctgatg
aatcatctgaaagagtatcacatcaaacataacattctcaacttcctcacatacgcagat
gaatatgcaattggctacttcaagaaacaaggtttctccaaagatattaaagtaccaaaa
gcaaaatatgttggctatatcaaggattatgaaggagccactttaatgggatgtgaattt
ntcatcattaaaaagaaaaaagagatcattaaaaagctaattgaaagaaaacaagcgcag
atccgaaaagtctatcctggcctttcctgcttcaaagatggagtacgacagattcctata
gaaagtattcctggaattagagaaactggctggaaaccaagtggaaaagagagaggtaaa
gaacccaaagatccagatcagctttacagcacattaaaaaccatcctgcagcaggtgaag
agccatcaaagcgcttggcccttcatggaacctgtgaagagaacagaagctcccggatat
tatgaagttataaggtttcccatggatctaaaaaccatgagtgaacgactcaagaatagg
tactacgtatctaagaaactattcatggcagacttgcagcgggtctttacaaattgcaga
gagtacaatccccctgagagtgaatactacaaatgtgccaatatattggagaaattcttc
tacacgaaaattaaagaagctggattaattgacaagtga

DBGET integrated database retrieval system