KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102448624Help
Entry
102448624         CDS       T02980                                 

Gene name
PIK3CA
Definition
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit alpha
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102448624 (PIK3CA)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    102448624 (PIK3CA)
   04370 VEGF signaling pathway
    102448624 (PIK3CA)
   04630 Jak-STAT signaling pathway
    102448624 (PIK3CA)
   04068 FoxO signaling pathway
    102448624 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    102448624 (PIK3CA)
   04150 mTOR signaling pathway
    102448624 (PIK3CA)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    102448624 (PIK3CA)
  Cell growth and death
   04210 Apoptosis
    102448624 (PIK3CA)
  Cellular commiunity
   04510 Focal adhesion
    102448624 (PIK3CA)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    102448624 (PIK3CA)
  Endocrine system
   04910 Insulin signaling pathway
    102448624 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    102448624 (PIK3CA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102448624 (PIK3CA)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102448624 (PIK3CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1062 aa AA seqDB search
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLLNIKHELFKEARKYPLYQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDVNAPHSRALYVCPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYLLEKYPLSQYKYIRSCIILGRMPNLMLMAKESLYTQLPLD
TFTMPSYSRRISTATPYMNGEASAKSLWAINSALRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLLYDMYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINMFDYTHTLVSGKMALNLWAVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSPVKFPDMTVIEEHANWTISRELGFNYSHAGLSNRIARDNELRESDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVNTPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPLVRAFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKNVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFISPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEMYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMXLQSFDDIAYIRKTL
ALDKSEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaagaccatcatctggtgaactatggggcatccatttaatgccaccgaggatc
cttgtagagtgtctcctacctaacggaatgatagtgactctagaatgcctccgtgaggcc
acactactgaatatcaagcatgaactcttcaaagaagcaagaaaataccctctttaccag
ctgcttcaagatgaatcttcttacatttttgtaagtgttacacaagaagcagaaagagaa
gaattttttgatgaaacacggcggctttgcgacctacgactctttcagccttttctaaaa
gtcattgaaccagtaggcaacagagaagaaaagattcttaatcgggaaattggttttgct
ataggcatgcctgtctgtgaatttgatatggttaaggatccagaagtgcaggacttcagg
agaaatattcttaatgtttgtaaagaagcagtggaccttcgagatgtgaatgcaccccat
agtagagcattatatgtctgtcctccaaatgttgaatcttcacctgaactgcccaagcac
atatacaataaactagataaagggcaaataatagtggtgatatgggtaatagtctccccg
aacaatgacaagcagaaatataccttaaaaatcaaccatgactgtgttcctgagcaagtt
attgctgaagcaatcaggaaaaaaacacgaagtatgttgctgtcatctgaacaactaaaa
ctctgcgttttagagtaccagggcaagtatattttaaaagtgtgtggctgtgatgaatac
ttgctagaaaaatatccactgagccagtataagtacataagaagttgtataatacttggc
cgaatgcccaacctgatgctgatggctaaggaaagcctttatacacaactgccactggat
acctttacaatgccatcttattccaggcggatctctacagctacaccatacatgaatggc
gaagcttcagccaaatctctctgggccataaacagtgctctcaggataagaattctctgt
gccacctatgtaaatgtaaacattcgagacattgataagatctatgttcgaactggtatc
taccatggaggagaacctttatgcgacaatgtgaatactcaaagggtaccttgttccaat
ccaagatggaatgaatggctattgtatgacatgtacattcctgatctcccacgtgctgct
cggctttgcctttccatctgctctgttaaaggcagaaagggtgctaaggaggaacactgt
ccattggcttggggaaatataaacatgtttgattacacacatactcttgtatctgggaaa
atggctttgaatctgtgggctgtgcctcatgggctggaagatctgctaaatcctattggc
gttacagggtcaaatccgaataaggaaactccatgtttagagctggaatttgattggttt
agcagccctgtaaagtttccagacatgacagtgattgaagaacatgccaattggactata
tctcgagaactagggtttaactacagccatgcgggactgagtaacaggatagctagagat
aatgaattaagagaaagtgacaaagagcaactccgtgcaatttgtacacgagaccctctg
tctgaaatcactgagcaagagaaggacttcctttggagccacagacactattgtgtaaat
accccagaaattctaccaaaactacttttgtctgttaagtggaactctagagatgaagta
gcccagatgtactgcttggtaaaagactggcctccaatcaagccagaacaggcaatggag
cttttggactgtaattatcctgatccattggtgcgagcgtttgcagttcggtgtctggag
aagtatttgacagatgataaattgtctcagtacttaatccagcttgtacaggttctgaaa
tatgagcagtatttggataatctactggtgagatttttactcaagaaggcactgaccaat
caaaggataggacattttttcttttggcacttaaaatccgaaatgcataataaaaatgta
agccagagatttggcttacttttggagtcctactgtcgagcatgtggaatgtacctaaaa
catttgagcaggcaggtggaagctatggagaaactgataaacctcacagatattctcaag
caggagaagaaggatgagacacaaaaggtgcagatgaagtttcttgttgagcaaatgagg
cgaccagatttcatggatgccttacaaggctttatttctcctcttaaccctgctcatcag
ctgggaaatctcaggcttgaggaatgcaggattatgtcctctgcaaaaaggccactctgg
ttgaactgggaaaacccagatattatgtctgaactgttgtttcaaaacaatgaaatcatc
tttaaaaatggagatgatttacgtcaggacatgctgacacttcaaatcattcgaattatg
gaaaatatctggcaaaatcagggtcttgatcttcggatgttgccttatggctgtttgtct
attggtgattgtgtgggacttattgaggtggtgagaagctctcatacaattatgcaaatt
cagtgtaaaggtggtctaaaaggtgcattgcaattcaacagccacacattacatcagtgg
ctcaaggacaagaacaaaggagaaatgtatgatgcagctattgatttgtttacacgctct
tgtgctggctattgtgttgctaccttcatactgggaattggtgatcgtcacaatagtaat
atcatggtgaaagatgatggacaactgtttcacatagattttggacactttcttgatcac
aagaagaaaaaatttggttacaaacgagagcgtgtgccatttgtcttaacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgtaccaaaacaagggaatttgaaaggttt
caggagatgtgttataaggcttacttggcaattcggcagcatgctaatctcttcataaat
ctcttctccatgatgncactacaatcttttgatgatattgcctacatacgaaagacgctt
gcactggacaaaagtgaacaagaagctctagaatatttcatgaaacagatgaatgatgct
catcatggtggctggacaacaaaaatggactggatcttccacacaataaagcaacatgca
ttgaactga

DBGET integrated database retrieval system