KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102449457Help
Entry
102449457         CDS       T02980                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2 (liver)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102449457 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102449457 (GYS2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102449457 (GYS2)
Enzymes [BR:pss01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102449457 (GYS2)
Glycosyltransferases [BR:pss01003]
 Polysaccharide
  Storage polysaccharide
   102449457 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
ENSPSIG00000009942
UniProt: 
Position
Un
AA seq 704 aa AA seqDB search
MTLVRSLSVTSLNGLPQWEDEDLPVEDLLLFEVAWEVTNKVGGIYTVIQTKAKITADEWG
ENYFLIGPYFEQNVKTQVEVCEPPNPAIKKAVDTLKGQGCQVFFGRWLIEGSPYVMLFDI
GSAAWNLDRWKGEFWDACNIGIPFHDREANDALIFGSLTAWFFKELSSQFDDTPNLIAHF
HEWQAGAGLILSRFRKLPVATIFTTHATLLGRYLCAANIDFYNKLDQFDIDREAGDRQIY
HRYCMERASVHCAHVFTTVSQITAIEAEHMLKRKADVITPNGLNIKKFSAMHEFQNLHAM
YKARIQEFIRGHFYGHLDFNLARTLFFFIAGRYEYSNKGADIFLEALSRLNFLLRVHRSD
VTVVVFFIMPAKTNNFNVETLKGQAIRKQLWDTAQSVKEKFGKKLYDALLKGEIPDLNKI
LDRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPMDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFVQ
EHVADPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRYYMHARHLALSRTFPDKFEMEPNAPPKTDGFRYPRPSSVPPSPSASQHSSPHHSEG
EDEDEDERYDEEEEAERDRQNIKSPFSLGVLPQGKKKQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgactctggttagatcactgtctgtgacctctcttaatgggcttcctcagtgggaagat
gaagacctgccagtggaggatttattgctctttgaagtggcttgggaagttaccaataaa
gttggtggcatctatactgtgatccagacaaaagccaaaattactgctgatgaatggggt
gaaaattattttctgatcggtccctattttgagcaaaacgtgaagactcaggtagaggtg
tgtgagccgccaaacccagcaattaagaaggcagtggacacattgaaaggtcaggggtgt
caggtattttttggaagatggctgatagaaggcagcccatatgtgatgctctttgacata
gggtcagcagcctggaatctggacagatggaaaggagaattctgggatgcatgcaacata
ggaatcccttttcatgacagagaggccaacgatgcactgatctttggatcgttaactgcc
tggttctttaaagagctctccagccagtttgatgacacacccaacttgattgcccacttt
cacgaatggcaggcaggcgctgggctcatcctttctcgatttaggaaacttccagttgcc
acaatctttactacccatgccacacttctcgggaggtacttgtgtgctgcaaatatagat
ttctataacaaacttgaccagtttgatatagacagagaagcaggagacagacagatttac
caccggtactgtatggaacgagcatctgtacattgtgctcatgttttcaccacggtttct
cagataacagccatagaagcagagcacatgcttaagagaaaagctgatgtcattactcca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcatgccatg
tacaaggctaggatccaagagttcatccgaggccatttctacggccatcttgacttcaac
cttgcaaggaccttgtttttcttcattgctgggagatatgaatattcaaacaaaggagct
gatatatttctagaggccttatccagattaaacttcctgcttagggttcacagaagtgat
gttacagtcgtcgtgttcttcatcatgccagcgaagacgaacaatttcaacgtggaaaca
ctgaaaggccaagcaatacgaaagcaactgtgggacaccgcacaatctgtgaaagaaaaa
tttggaaagaaactctatgatgcactcctgaagggagaaattccagatttgaacaagatt
cttgaccgggatgacttaaccattatgaaaagagccatcttttcaactcagcggcagtct
ctgcctccagtgaccacccacaacatgattgatgattccaatgacccaatcctcaatacc
atccggcgcatcggactcttcaataaccgcacggacagagttaaagtgatattacaccca
gagttcctgtcttcaacaagtccattattacccatggactatgaagattttgtcagaggt
tgccatttgggggtgtttccatcctattatgagccatggggttacactccagctgagtgc
actgtgatgggcattcccagtgtgaccacaaacctctctggatttggctgtttcgtgcag
gagcatgtagctgacccagcggcgtatggcatttacatagttgacaggaggttccgctcc
cccgatgaatcgtgtaaccagttgactcagttcttgtatggattttgccagcagtcacgg
cgccagaggattatccagagaaatcgaacggagaggctctcagatctactagactggaga
tacttaggcaggtactatatgcatgccagacacctggctctgagcagaactttcccagat
aaatttgagatggaaccaaatgctccaccaaagacagatggttttaggtaccctcggcct
tcatcagtgcccccatcaccttccgcgtctcaacattccagccctcatcatagcgaaggg
gaggacgaagatgaggatgaaagatatgatgaggaggaagaggccgaaagggacaggcaa
aacataaagtcacctttttccctcggagtactgccacaaggaaagaaaaagcaacatgga
gaatataggaactga

DBGET integrated database retrieval system