KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102449457Help
Entry
102449457         CDS       T02980                                 

Gene name
GYS2
Definition
glycogen synthase 2 (liver)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102449457 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102449457 (GYS2)
Enzymes [BR:pss01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102449457 (GYS2)
Glycosyltransferases [BR:pss01003]
 Polysaccharide
  Storage polysaccharide
   102449457 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 704 aa AA seqDB search
MTLVRSLSVTSLNGLPQWEDEDLPVEDLLLFEVAWEVTNKVGGIYTVIQTKAKITADEWG
ENYFLIGPYFEQNVKTQVEVCEPPNPAIKKAVDTLKGQGCQVFFGRWLIEGSPYVMLFDI
GSAAWNLDRWKGEFWDACNIGIPFHDREANDALIFGSLTAWFFKELSSQFDDTPNLIAHF
HEWQAGAGLILSRFRKLPVATIFTTHATLLGRYLCAANIDFYNKLDQFDIDREAGDRQIY
HRYCMERASVHCAHVFTTVSQITAIEAEHMLKRKADVITPNGLNIKKFSAMHEFQNLHAM
YKARIQEFIRGHFYGHLDFNLARTLFFFIAGRYEYSNKGADIFLEALSRLNFLLRVHRSD
VTVVVFFIMPAKTNNFNVETLKGQAIRKQLWDTAQSVKEKFGKKLYDALLKGEIPDLNKI
LDRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPMDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFVQ
EHVADPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRYYMHARHLALSRTFPDKFEMEPNAPPKTDGFRYPRPSSVPPSPSASQHSSPHHSEG
EDEDEDERYDEEEEAERDRQNIKSPFSLGVLPQGKKKQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgactctggttagatcactgtctgtgacctctcttaatgggcttcctcagtgggaagat
gaagacctgccagtggaggatttattgctctttgaagtggcttgggaagttaccaataaa
gttggtggcatctatactgtgatccagacaaaagccaaaattactgctgatgaatggggt
gaaaattattttctgatcggtccctattttgagcaaaacgtgaagactcaggtagaggtg
tgtgagccgccaaacccagcaattaagaaggcagtggacacattgaaaggtcaggggtgt
caggtattttttggaagatggctgatagaaggcagcccatatgtgatgctctttgacata
gggtcagcagcctggaatctggacagatggaaaggagaattctgggatgcatgcaacata
ggaatcccttttcatgacagagaggccaacgatgcactgatctttggatcgttaactgcc
tggttctttaaagagctctccagccagtttgatgacacacccaacttgattgcccacttt
cacgaatggcaggcaggcgctgggctcatcctttctcgatttaggaaacttccagttgcc
acaatctttactacccatgccacacttctcgggaggtacttgtgtgctgcaaatatagat
ttctataacaaacttgaccagtttgatatagacagagaagcaggagacagacagatttac
caccggtactgtatggaacgagcatctgtacattgtgctcatgttttcaccacggtttct
cagataacagccatagaagcagagcacatgcttaagagaaaagctgatgtcattactcca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcatgccatg
tacaaggctaggatccaagagttcatccgaggccatttctacggccatcttgacttcaac
cttgcaaggaccttgtttttcttcattgctgggagatatgaatattcaaacaaaggagct
gatatatttctagaggccttatccagattaaacttcctgcttagggttcacagaagtgat
gttacagtcgtcgtgttcttcatcatgccagcgaagacgaacaatttcaacgtggaaaca
ctgaaaggccaagcaatacgaaagcaactgtgggacaccgcacaatctgtgaaagaaaaa
tttggaaagaaactctatgatgcactcctgaagggagaaattccagatttgaacaagatt
cttgaccgggatgacttaaccattatgaaaagagccatcttttcaactcagcggcagtct
ctgcctccagtgaccacccacaacatgattgatgattccaatgacccaatcctcaatacc
atccggcgcatcggactcttcaataaccgcacggacagagttaaagtgatattacaccca
gagttcctgtcttcaacaagtccattattacccatggactatgaagattttgtcagaggt
tgccatttgggggtgtttccatcctattatgagccatggggttacactccagctgagtgc
actgtgatgggcattcccagtgtgaccacaaacctctctggatttggctgtttcgtgcag
gagcatgtagctgacccagcggcgtatggcatttacatagttgacaggaggttccgctcc
cccgatgaatcgtgtaaccagttgactcagttcttgtatggattttgccagcagtcacgg
cgccagaggattatccagagaaatcgaacggagaggctctcagatctactagactggaga
tacttaggcaggtactatatgcatgccagacacctggctctgagcagaactttcccagat
aaatttgagatggaaccaaatgctccaccaaagacagatggttttaggtaccctcggcct
tcatcagtgcccccatcaccttccgcgtctcaacattccagccctcatcatagcgaaggg
gaggacgaagatgaggatgaaagatatgatgaggaggaagaggccgaaagggacaggcaa
aacataaagtcacctttttccctcggagtactgccacaaggaaagaaaaagcaacatgga
gaatataggaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system