KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102450878Help
Entry
102450878         CDS       T02980                                 

Gene name
ABAT
Definition
4-aminobutyrate aminotransferase
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    102450878 (ABAT)
   00650 Butanoate metabolism
    102450878 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102450878 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    102450878 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102450878 (ABAT)
Enzymes [BR:pss01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     102450878 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     102450878 (ABAT)
Amino acid related enzymes [BR:pss01007]
 Aminotransferase (transaminase)
  Class III
   102450878 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 500 aa AA seqDB search
MASMLLSRQLTCSLQQNCRLFACGHRLISQTAAKIDVDFDYDGPLMKTEVPGPRSRELMK
QLNGIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPSLIKLLQQPQ
NLSTFVNRPALGILPPENFAEKLKESLLSVAPKGLQQVITMSCGSCSNENAFKAIFMWYR
NKERGNNNVTKEELETCMINQAPGCPDYSILSFMGGFHGRTMGCLATTHSKAIHKLDIPS
LDWPIAPFPRLQYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKRIVAGIIIEPIQSEGG
DNHASDDFFKKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPTDMVSFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPAKNLLLAEVINVIKREDLLNNATHAGKALLAGLL
DLQTRYPHLISRARGRGTFCSFDTPNDATRNKLIAVARNKGVVLGGCGDRSIRFRPTLIF
KDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaatgttgctcagtcgacagctgacttgttccctgcaacagaactgcaggctc
tttgcatgtgggcacagattgatcagtcaaactgcagctaaaattgatgtggacttcgat
tatgacggaccattaatgaagacagaagttcctgggcctaggtctagagagttaatgaaa
cagctaaatggaattcagaatgcagaagctgtgcactttttttgcaattatgaagaaagc
cgaggtaactaccttgtagatgtagatggaaaccgtatgctggatctctactctcagatt
tcatccatcccaataggttacagccatccatctctgataaaacttctccagcagccacag
aatttgagtacatttgttaataggcctgctcttgggattttacctccagagaattttgct
gaaaaattaaaggaatctttgctttctgtggctcctaagggcctgcagcaggttatcacc
atgtcctgtggatcctgttctaatgaaaatgcctttaaagcaatattcatgtggtacagg
aacaaggaaaggggtaataataatgtcacaaaggaagaattggagacgtgcatgattaac
caggctccaggctgtcctgattatagtattctgtcctttatgggtggattccatggaaga
acgatgggctgcttagctacaactcactctaaggcaattcacaaattagacatcccctcg
ttagactggccaattgctccatttccaagactacaataccccctggaagagtttgtgaaa
gagaatcaacaggaagaagcccgctgtttagaggaggtagaagatctgattgtaaagtac
agaaaaaagaagaggattgttgctggaataatcattgaaccaattcagtcagaaggggga
gacaatcatgcttcagatgatttctttaagaagttacgggacatagccagaaagcatggc
tgtgcatttctggtggatgaggtacagacaggaggtggctgcaccgggaagttttgggcc
catgaacactggggcctcgacgaccccactgatatggtatcatttagtaagaagatgatg
acaggaggattttttcacaaggaggagttcaggcccaatgctccatatcggatttttaat
acctggcttggggatcccgccaagaacctcctgcttgctgaagtgattaatgttattaag
agggaagacctcctaaacaatgcaactcatgcaggcaaagctctactggctgggctgctg
gacttgcagactcgttaccctcatctcatcagcagagcaaggggacgggggacattctgt
tcgtttgacactccaaatgatgcaactaggaacaagttaattgcagtagctagaaacaaa
ggtgttgtgctgggaggctgtggtgacaggtcaatccgtttccgtccaactctgatcttc
aaggatcaccacgcgcacctctttctgaacatcttcagtgacatcttagcagacttcaag
taa

DBGET integrated database retrieval system