KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102451231Help
Entry
102451231         CDS       T02980                                 

Gene name
KAT6A
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102451231 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1984 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDGKPNVDWNKLIKRAIEGLAESSGSSLKN
IERFLKGQKDVSTLFGGSGTSIFHQQLRLAVKRAVGHGRLLKDGPLYQLNTKAAINAEGK
ESCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHP
SCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTR
MPKGMWICQICRPRKKGRKLLHKKAAQIKRRYANPIGRPKNRLKNQNTTSKGPFNKVRTG
PGRGRKRKITLSSQSASSAEGYLERLDGLEFCRDSGTTLKFNKKTKGLIDGLTKFFTPSP
DGRKARGEMVDYSQQYRIRKKGARRSSTSDWPTDNQGGWDGKQDNEERLLGSQDDMIETD
MELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTG
ICPQDITSTLHHLRMLDFRKDQFVIVRREKLIQDHMTKLQVNLRPVAVDPECLRWTPVIV
SNTVVSEDEEEETEEGENEEQQQKEREVSVKVVKSVLWEKKEQEPYSLMENEKKPVIVIP
DSSTRPNKQVLPLDNLPANSQPSRRGRWSRKGKKLQEPFSEKEQKLLMEDKSAVPTASRG
RCGECEEKSPAARGRYGEEEEKSAVPQGQPGKGEKSSAPRRRYSEGMEMWRGQLKNSTEL
LKCRFTEECDRLPRRYSDSDRTLLRCFSESSEEEEDEPVSPRSDSPPVLTKPTLKRKVCA
PGVLSSLAASRSRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFELEEEEEE
DESELFTRGYFRHLAPQDTLRRRPSSKRKSKDEEESDDTNGTPTLKPISVLRKCEAKISP
FEADTSTPMKKKKGWPKGKSRKPIHWKKRPGRKPGFKLNRERVPVAAQDGGVDAMVTNSK
PGRKPKMQEKEESLQKKEEQPLAEEKKEEDMHIGTEEVGEGEEEDATSSEVRAVSPVDSS
SSPAANVKEPEVEEEVEEKPPVLEEPRQSEEEQQELEEPEHDHEEEDDEVAVVINQNEDH
DADDEDDGHLDSAKKKELEELPIREEVKEEPDVQESFLEPSIQSSREEVKGKNEAEADSE
EEQASHETSVASEHVPGSEDDHEEEQNSKERLIELKEEEEIPHSELDLETVQAVQSLTQE
ESHEHDVAYQDCEETLAACQNLQSYTQTDEDPQISMVEDCHASEHNSPISSVQSHPSQSV
RSVSSPNVPALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLG
SIESTTENYENPSSYDSTMGGSICGNNSSQSSCSYGGLSSSSSLTQNSCVVTQQMANIGS
SCSMMQQSTVQPAANCSIKSPQSCVVERPPSNQQPAPQPQQQQQPQPQQPQPPPPPQQQP
PLSQCSMNNSFTPAPMIMEIPESGSTGNISIYERIPGDFGAGSYSQPSATFSLAKLQQLT
NTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLAGTPQAQATMTPPPNLASTT
MNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSAPLPSATAHQQQLYGRSPP
AVAMQAGPRALAVQRGMNMGVNLMPTPPYNVNSMNMNTLNAMNSYRMTQPMMNSSYHSNP
AYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGPSHHSYMNAAGVPKQSLNGP
YMRR
NT seq 5955 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgctaacccgctgtatacggagtggattttggaggcaatcaaaaaagtg
aagaagcaaaaacagcgcccttcagaggagcggatatgcaatgcagtatcttcatcccat
ggtttggaccgaaaaactgtcctggaacaactagaattgagtgttaaagatggaactata
ttaaaagtctccaacaaaggtctcaattcctacaaggatcctgataatcctgggagaata
gcacttcctaaacctcgaaaccatggaaagttggatggtaaaccaaacgtggactggaat
aaactaatcaaacgagcaattgagggcttggcagagtccagtggttcatccttgaagaat
attgaacgctttttgaaaggtcagaaggatgtgtccacattgtttggaggtagtggtacc
tccatctttcaccagcaattgcgactagctgtcaagcgtgctgttggccatggcagactc
cttaaagatggacctttgtaccaactcaacactaaagcagccatcaatgctgaggggaaa
gagagctgtgagtctctttcctgtctgcctccagtgtcactccttccccatgaaaaggat
aagccagttgctgaaccaatcccaatctgcagtttctgccttggtacaaaagaacagaat
cgtgagaagaaacccgaggagcttatctcttgcgctgattgtggcaacagtggtcatccg
tcctgtttgaagttctctccagagctaacagttcgagtgaaggccttacgatggcagtgc
atcgagtgcaaaacttgtagctcctgtcgagatcaaggcaaaaatgcagataacatgctg
ttttgtgactcgtgtgaccgaggctttcatatggagtgctgtgacccccctctcaccagg
atgccgaaaggtatgtggatatgtcaaatatgccggccacggaagaaaggaagaaaactt
ttacacaagaaggcagcacagataaaacgacgctatgccaacccaataggacgtcctaaa
aacaggttaaagaaccaaaacacaacatcaaaaggccccttcaacaaagttcgaactggc
cctggtcggggccggaagcgcaagatcacactatccagccaatcagcatcatcggccgaa
ggatacctggaacggctagatggcctggaattctgcagagatagtggcaccaccttgaaa
tttaacaagaaaaccaaagggcttattgatggccttaccaaattcttcactccttcccct
gatgggcggaaagctcgaggggaaatggtggactattctcagcaatacagaatcaggaaa
aagggagccagaagatctagcacttcagattggcctacagacaatcagggtggctgggat
ggaaaacaggacaatgaggaacggcttcttgggagccaggatgacatgattgaaacagat
atggagttgttccgagacattcaggaacaagcgttgcagaaagtaggagtgacagggccc
cctgatccacaagtccgctgtccttcggttatcgagtttgggaagtatgaaatccacacc
tggtactcttccccatatccacaggaatactccaggctacctaaattgtacctttgtgaa
ttctgtctaaagtatatgaaaagtagaactatcctccagcagcatatgaagaagtgtggc
tggtttcatcctccagccaatgaaatttacagaaagaacaatatttcagtctttgaggtt
gatggcaacgtcagtaccatttactgccagaacctgtgtttgctggcaaaactcttcttg
gaccacaagacactctattatgatgtggagccatttcttttctatgtgctaacacagaat
gatgtgaagggctgccaccttgtaggctatttctcaaaagagaagcactgccaacagaag
tacaacgtttcctgtataatgattcttccccagtaccagcgtaagggctatggcagattc
ctcattgacttcagctatctgctatcaaagcgtgagggccaagcagggtccccagagaag
ccattgtctgatctgggccgtctctcatacatggcttattggaaaagtgtaatattggag
tgcctttatcatcaaaatgacaaacaaatcagcataaaaaagctaagcaaactcactgga
atctgccctcaagacatcacttccactctccatcacctacgaatgcttgacttccgcaag
gaccaatttgttattgttcgtcgggagaagcttatccaggatcatatgacaaagctccag
gtgaatctccggcctgtagctgtagatccagaatgtctgcgctggacacctgttattgtt
tccaacactgtagtttctgaggatgaagaggaagagactgaggaaggagaaaatgaagag
cagcagcagaaggaacgagaggtcagtgtaaaagtggtaaaatctgtattgtgggagaag
aaggaacaagagccttattctctgatggagaatgaaaaaaagccagtaattgtaattcca
gacagttctacacggcccaataagcaagttcttcccctggataatcttcctgcaaacagc
cagccatctcggagaggccgatggagccgaaaaggcaaaaaactgcaagaaccctttagt
gagaaggaacagaaattgctcatggaggataagtcagcagtccccacagcctcgcggggg
cgctgtggggaatgcgaggagaaatctccagccgcacgggggcgctatggtgaagaggag
gaaaaatctgcagtccctcagggacagcctggcaaaggtgaaaagtcctcagccccacga
aggcgatacagtgaaggcatggaaatgtggagggggcagctaaagaacagcactgagctc
ctgaaatgcaggttcacagaggagtgtgacagattgccccggcgatatagtgacagtgac
aggactctcctgaggtgctttagtgaaagtagtgaagaggaggaggatgagcctgtgagt
cctcgttcagactctccgcctgttctcaccaagccaactttaaaacgaaaggtatgcgct
cctggtgttctctcatctctggctgcaagccgcagtcgcaagcaccacaatagtagtgtt
gtcactgaaacaatctctgagaccacagaggtgttggatgaaccttttgaggactctgat
tctgaaagaccaatgccccggttggagcctacctttgagctagaagaggaagaggaagag
gacgagagtgaactgttcactcgggggtactttcgccacttagccccccaagataccctt
aggcgcagaccctcctctaagaggaagtccaaagatgaagaggagtctgatgacactaat
ggcacccctaccttgaagccaatatctgtgctcagaaagtgtgaagcaaagatttctcca
tttgaggcagatacttccacacccatgaaaaagaagaagggatggcccaaaggcaaaagt
cgcaaacctatccactggaagaaaagacctggtagaaagccagggtttaaactgaatcgg
gaaagggtgccagtagctgctcaggatgggggagttgatgccatggtaactaattcaaaa
ccaggacgtaaacccaaaatgcaggagaaagaagagtctcttcagaagaaagaagagcag
cccctcgctgaggagaagaaggaggaagacatgcatattggaacagaggaggtgggagag
ggagaagaggaagatgcaactagtagtgaagtgagagcagtttctcctgtggacagcagc
agcagtccagcagccaatgttaaggagcctgaggtggaggaagaagtagaggagaagcca
ccggtattagaagaaccaaggcaatcagaagaagaacagcaagaattggaagaacctgag
catgaccatgaagaagaggatgatgaagtggcagtagttataaaccaaaatgaagaccat
gatgcagatgatgaagatgatggtcaccttgactctgcgaagaagaaagaattggaggaa
ctgccaattagggaagaagtgaaggaggagcctgatgtccaggagtcttttttagaacca
agcatacaaagcagtagagaagaggtgaagggcaaaaatgaggcagaggcagattctgag
gaagagcaggcttcccatgagacatcagtggcctcagagcatgtccctggctctgaagat
gatcatgaagaagagcaaaattctaaagaaaggttaattgaattaaaggaagaggaagag
attcctcatagtgaactagatctggaaactgtccaagcagtccagtccttgacgcaagag
gagagtcatgagcatgatgtagcgtaccaggactgtgaggaaactcttgcagcttgtcag
aatttgcagagttacactcaaacagatgaggaccctcagatatcaatggttgaagattgc
catgcctcagaacacaacagtccaatatcctctgttcagtcccatcctagccaatctgta
cgttcggtcagcagtcccaatgtgcctgctttggagagtggttacacccagataagcccc
gaacaaggatccctgtccgcaccctctatgcagaacatggagaccagccccatgatggat
gtgccttctgtatcagaccactctcagcaggtggtggacagtggcttcagtgacttgggc
agcattgagagcaccacagagaactacgaaaaccccagcagttatgactccaccatggga
ggcagcatttgtggaaataactcttcccagagcagctgctcctatggggggttgtcctcc
tctagtagcctcactcagaacagttgtgttgtcactcagcaaatggcaaacatcggcagc
agctgcagcatgatgcaacagagcactgtccagcctgctgcaaactgcagcatcaagtca
cctcagagctgcgtggtagaaaggcctccaagcaaccagcaaccagccccccagccgcag
cagcagcagcagcctcagccgcagcagcctcagcccccacccccaccccagcagcaacct
ccactgtctcagtgtagcatgaataatagtttcacccccgcaccgatgatcatggagata
cctgaatctggcagcactggcaacataagtatctatgagaggatcccaggagattttggt
gctgggagctactctcagccatcagccacattcagtttagccaagttgcagcagctgaca
aacaccattatggaccctcatgccatgccttatagccattctcctgctgtgacttcctat
gcaaccagtgtttctctgtccaacacagggttggctcagctagctccatctcatccatta
gctgggacgccgcaagcacaagccaccatgacacccccaccaaacttggcctccaccacc
atgaacctcacatcccctcttcttcagtgtaacatgtctgccaccaacattgggatccca
catacgcaacggttgcaggggcaaatgccagttaaggggcatatttccattcgttccaaa
tccgcaccactgccctctgcaacagcacaccagcagcagctctatgggcgcagcccacca
gcagttgccatgcaggctggccctcgtgcgctagctgttcagcgaggtatgaacatgggg
gttaacttgatgccaactcccccctacaatgtcaattccatgaatatgaacaccctgaat
gccatgaacagctacagaatgacacagcccatgatgaacagcagttaccatagtaaccct
gcctacatgaaccagacagcacagtatcctatgcagatgcagatgggaatgatggggagc
caggcctatacccagcagcctatgcagccaaaccctcatggaaacatgatgtatactggc
ccctcccatcacagctacatgaatgctgctggggtgcccaagcagtcgctcaatggaccg
tacatgagaagatga

DBGET integrated database retrieval system