KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102451950Help
Entry
102451950         CDS       T02980                                 

Gene name
GTF3C4
Definition
(RefSeq) general transcription factor IIIC, polypeptide 4, 90kDa
  KO
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102451950 (GTF3C4)
Transcription machinery [BR:pss03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     102451950 (GTF3C4)
Chromosome [BR:pss03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102451950 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 690 aa AA seqDB search
CVLIILILFQVGSKKEVAECKEKFASSKDPTVSQTFMLDRVFNPEGKSLPPXSPLGCDAN
GRCLLAALTMDNRLTIHANLNRLQWVQLVDLTEIYGERLYENSYKLSKLEAPRGDLGDFA
EFQRRHSMQTPVRMEWSGICTTXXXAVLFENGNIAVWQFQLPFVGKESITSCNTIESGIN
SPSVLSWWEYEHNNRKMSGLIVGSAFGPVKILPVNLKAVKGYFTLRQPVVLWQEMDQLPV
QSIKCIPLYHPYQKCSCSLVVAARGSYVFWCLLLISKAGLNVHNSHVTGLHSLPIVSMTA
DKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQLIKLSEVFGSVRTHGIAVSPCGAYLAV
ITTEGMTNGLHPVNKNYLVQFVTLKTFEEAAAQLLESSVQNLFRQVDLTDLVRWKILKDK
HIPQFLQEALDKKVESCGSTYFWRFKLFLLRILYQSMQKTPSEIMWRPSHEDTKILISDS
PGMGSTEDDHQEEGTSKQASKQSLCEVSKGTDAGDPADDTLAHSSDIVGHEPMEEKLLEI
QAQIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGVCDFLMSDEGYDDRTARVLIG
HILKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLVYRRCLLHD
SIARHPTPEDPEWIKRLLQGPCTFCDSPVF
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
tgtgttttaataatacttattctgtttcaggttggttcaaaaaaggaggttgcagaatgt
aaggaaaagtttgcaagctctaaggatccaactgttagtcaaacctttatgctagataga
gtattcaaccctgaaggaaagtcacttccacctnnatctccactgggctgtgatgctaat
ggaagatgccttctagcagctctaactatggacaatagattaaccatccatgctaacctc
aacagactacagtgggtgcagctggttgatctgacagagatttatggagagcgtctgtat
gaaaacagttacaaactttctaagcttgaggcccccagaggagatctaggggactttgca
gaatttcagagacggcatagcatgcagactccagttcgtatggagtggtccggtatctgc
accaccnnnnnnnnngccgtactctttgaaaatggaaacattgcagtttggcaatttcag
cttccttttgtgggtaaggaatccattacttcgtgcaataccatagagtcaggaataaat
tcccctagcgtcttgtcttggtgggaatatgaacacaacaaccgaaagatgagtggactc
attgtagggagtgcttttggaccagttaaaatccttcctgttaacttaaaagcagttaaa
ggctactttacacttagacaaccagttgtcttatggcaagaaatggatcagttgcccgta
cagagtatcaaatgtattcctctctaccatccttatcaaaaatgtagctgtagcttagtg
gtggctgcaagaggatcttatgtgttttggtgtcttctcttgatatccaaagcaggtctg
aatgtccataattcccatgtaacagggcttcattctttaccaattgtatccatgactgca
gacaaacaaaatggcacagtatacacatgctcaagtgatggaaaggtaaggcaacttatt
cccatcttcacagacgttgcattaaagtttgagcatcagcttattaagctgtcggaagtg
tttggctctgtgcggactcacgggatagccgtaagcccatgtggcgcatacctagcagtt
attacaacagagggaatgaccaacggccttcaccctgtaaacaaaaactatttagttcag
tttgtaactctcaaaacatttgaggaggcggctgctcagctcctggaatcttctgtccag
aatctttttagacaagtggacctgacagaccttgtgcgctggaagattttaaaagataag
catatccctcagttcttacaagaagccttggataaaaaggttgagagctgtggatcaact
tacttttggcgttttaagctattcctcttgagaattttgtaccagtcaatgcagaaaact
ccttctgagatcatgtggaggccttcacatgaagacacaaaaatattaatatcagattcc
cctggaatgggcagtactgaggatgatcatcaagaagagggaacgtcaaaacaggccagc
aagcagagtttgtgtgaagtgagcaaaggaacagatgcaggtgacccagcagatgacact
cttgcccactctagtgatatagtaggacatgagccaatggaagagaagctccttgaaata
caggcacaaattgaagcagtagaaatgcacttgacaagggaacacatgaagagggtgttg
ggagaagtttacttgcatacatggattacagagaacaccagcattcctaccagaggagta
tgtgatttcttaatgtctgatgaaggctatgatgacagaacagcacgagtgctgattgga
catattttaaagaaaatgaacaaacagactttcccagaacattgcagcctgtgtaaagag
atcttgccattcacagatcgcaaacaggcggtctgctccaatggccatatttggctcagg
tgctttttaacctaccagtcctgccagagtttggtatacagaaggtgtctgcttcatgac
agcattgcacggcatccaaccccagaagatcctgaatggatcaagaggttattacaagga
ccttgtactttctgtgattctcctgtattctag

DBGET integrated database retrieval system