KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102452114Help
Entry
102452114         CDS       T02980                                 

Gene name
F13A1
Definition
coagulation factor XIII, A1 polypeptide
Orthology
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102452114 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 742 aa AA seqDB search
MSEPTGIDKEKKNPIPPTLSGRRALPQNVSNAEEDEVPVMEMTGLVPRGVNLKDNFEVKE
VHMFKDTQEVNKQAHHTDKFYNPKLIVRRGQPFHIQIDFNRPYNPEKDQFWVEYVIGRYP
QQNKGTYIPVPLVEELQSGTWGAKITWKEDSSIRLSIMSAPTCIVGKFRLYVAIQTPFGI
LRTKRNPETDTYILFNPWCPEDSVFLDDEKERQEYVLNDIGVVFHGDINNIKSRSWNYGQ
FEEGILDACLYLMDRAKLDLSGRGNPVKIGRVGSAVINAKDDEGVVAGSWDNVYAYGVAP
SAWTGSVDILLEYHSSGMPVRYGQCWVFAGVFNTFLRCIGIPGRIVTNYSSAHDNDANLQ
LDVFVDEEGKVNPKLTKDSVWNYHVWNEAWMARPDLPVGFGGWQVVDSTPQENSDGMYRC
GPASVQAVKHGHVCFPFDAPFVYAEVNSDIVYSKAMKDGTRVIEHIDKTHIGKLILTKEI
GSDGTKDITEQYKFQEGTEEERLALETALMYGIKKEATPDTVLQIGTDVDMDFQVENTTL
GSDIKVTVTFRNNSHNRYTATAYLSGSIVFYTGVLKNEFKSHIFDVTLEPRTSKISEVLI
KSREYMSQLLEQASLHFFVTARLNETKKILAKQKTSVLQIPKLHIKVPGEKVVGKEMSVI
TEFTNPLNQKLENVWVRLDGPGLLKATTKMFREIPKNSTLTWEEKCIPRQAGVRKLIASL
NCDALRHVYGELDLEVERKPLV
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccaaccggcattgacaaagagaaaaaaaacccaattcctcctaccctgagt
ggccgtagagccctcccccaaaatgtctccaatgctgaagaagatgaggtccctgtcatg
gagatgactggtttggtacccaggggagttaacttgaaagataattttgaagttaaggaa
gttcacatgttcaaagatacccaggaagtcaacaagcaggcgcatcatactgacaagttc
tacaacccaaagttgattgtacggcgaggacagcctttccatatccagattgacttcaac
cgtccttacaatcctgaaaaagaccagttctgggtggaatacgtcataggtcgttatcca
cagcaaaacaaaggcacatacatcccagtccctttggttgaagaattgcaaagcgggaca
tggggagccaagattacttggaaggaagacagttccattaggctgtccatcatgtctgct
ccgacctgcattgtggggaaatttcgcctctatgtcgctatccagactccctttggcatc
cttcggacaaagagaaaccccgagactgacacctacatactctttaatccctggtgccca
gaggattcagtgtttctggatgacgagaaggaaaggcaagagtatgtcctgaatgacatt
ggtgttgttttccatggagacatcaacaatataaaatccagaagctggaattatggtcag
tttgaagagggcattctggatgcttgcctgtacttgatggatagagcaaaactagatctc
tctgggcgaggaaacccagtcaaaatcggtcgggttggatctgcagtgatcaatgctaaa
gatgatgagggagtggttgctggctcttgggacaatgtttatgcttatggagtagcaccg
tcagcctggacaggaagtgtagacatccttttggaatatcatagctctggtatgccagtg
agatatggtcagtgctgggtctttgctggagtcttcaatacatttttgaggtgcatagga
atacctggaagaattgttaccaattattcctctgcgcatgataacgatgccaatttacaa
ctggatgtctttgtggatgaagaagggaaagtgaaccccaaactcacaaaagactcagtc
tggaattatcacgtctggaacgaggcatggatggccagacctgatcttccagttggtttt
ggaggatggcaagtcgtagacagtactcctcaagaaaacagtgatggtatgtacagatgt
ggccctgcctcagttcaagctgttaaacatggtcatgtctgcttcccatttgatgctcct
tttgtttatgcagaggtgaacagtgatattgtttactcaaaagcaatgaaagatgggact
agagtgatcgaacacatcgataagacccacattgggaaattaatcctgaccaaggaaatt
ggcagtgatgggaccaaggacattactgaacagtacaaattccaggaaggcacagaagaa
gagagactggcccttgagacagctctgatgtatggcattaaaaaggaggctaccccggat
actgtgctgcagatagggactgatgtcgacatggactttcaagtagaaaatacaacactt
ggcagtgacatcaaagtcactgtaactttcagaaacaacagccacaaccgttacactgca
accgcctatctatctggcagtattgtattttatacaggtgtcttgaagaatgaattcaag
agccatatttttgatgtgacactggaacccaggacatctaaaatttctgaggtcttaatc
aaatcgagggagtacatgagtcagctgctggaacaggcctctttgcatttcttcgtcaca
gcacgtctcaatgaaacaaaaaagatcctggccaagcagaagacctctgtgctgcaaatc
cccaagcttcacatcaaggttcctggagagaaggtagttgggaaggaaatgtctgtgatc
acagaattcaccaacccactgaaccaaaagcttgaaaatgtctgggtacgtctcgatgga
cctgggctactgaaggcaaccacaaaaatgttcagagaaattccaaagaattctactttg
acctgggaagaaaaatgcattccaagacaagctggagttcgaaagctaattgcaagcctg
aattgtgatgccctacgacatgtctatggtgagctggacctagaggttgaaaggaaacca
cttgtgtaa

DBGET integrated database retrieval system