KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102454230Help
Entry
102454230         CDS       T02980                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102454230 (ART4)
Cellular antigens [BR:pss04090]
 Proteins
  102454230 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 303 aa AA seqDB search
MSYSSSPVDSGMTIHLLVCLLVLIFPLLGLKKGEKATSHIVMDMAPDSFDDQYQGCREQV
REELDRGDYFQKELGSNKNYSSIWEKAKLVWSKNPRALLREMQENHAVALTAYTMNTSLH
SDLNWAVSRAGRSPEHYNHSFPFKYLHFYLTTAVQLVRRWKSGTSRRKCYRVHRGVKGLY
FEAEIGTKVRFGRFTSTSLLRKEAQRFGNETIFTLMTCSGALVQDFSHYFSEREVLIPPY
EIFQVRNFSQTPSGNQLYLRSVGNYSQYNCQLLKASSSKNYIHNPPIAAFLSCVICAFFY
STR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatagcagctctcctgtggattctgggatgacaattcatctactggtctgcctg
ctggtgctgatcttccccctgctggggctgaaaaaaggagaaaaggccacatcccacatt
gtcatggatatggcaccagattcctttgatgaccagtaccagggttgccgtgagcaggtc
agggaggaactggatcgaggagactactttcagaaggaattgggtagtaacaagaactat
tccagcatctgggagaaagcaaagctggtctggtcaaaaaacccaagagctctgctaagg
gagatgcaggagaatcacgctgtagccctcacggcttacaccatgaacacctcgctgcac
tctgatttaaactgggctgtgtccagagctgggagatccccagagcactacaatcatagc
ttccccttcaaatacctccacttttacttgacaacagccgttcaactggtgaggagatgg
aaaagtggcacctctagaagaaagtgctaccgggtgcaccggggggtaaaaggcctgtat
tttgaggcggagataggcactaaagtgcggtttggccgcttcacttccacttcactcctc
cggaaggaagcccagagatttgggaacgaaacaatattcaccctgatgacttgctcaggg
gcgcttgtgcaagacttctcccactacttctctgagagggaggtcctcatcccaccctat
gagatattccaggtcagaaacttcagccaaacaccaagtggtaaccagctctatctgcga
tctgtgggaaattacagccagtacaattgccagctcctgaaagcttcaagcagcaagaac
tacatccacaatcctcctattgctgcctttctttcttgtgtgatctgtgctttcttctac
tctaccaga

DBGET integrated database retrieval system