KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102455447Help
Entry
102455447         CDS       T02980                                 

Definition
erythroblast NAD(P)(+)--arginine ADP-ribosyltransferase-like
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102455447
Cellular antigens [BR:pss04090]
 Proteins
  102455447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 265 aa AA seqDB search
MSGSITVFSFCLQGQGFPLGKRDLFPVTEAAASYWKERKDTSNVPQNFKPEYAMAVLAYS
SQGPLHMQPLHQEFNAAVREAGRTRDSYLSHFNFKTLHFLLTRALHVLKAAEPARCHQVY
RGVRGIRFKAEIRKPVRFGHFTSTSLKNDSALRFGQDTFFSIKTCFGANIKNFSFFPDED
EVLIPPFEKFKVTNFTQAQGRTMIQLQSLESSSNHNCEYVKEKRCKTRRCVFNSGMSSFS
SGPQHLYLLGGVLLMASALGAPGFL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctccatcaccgtgttctccttctgcctgcagggccagggattccccctcggc
aagagagacctcttccccgtcacagaggccgcagcctcctactggaaggagaggaaggac
actagcaacgtgccgcagaacttcaagcccgagtacgccatggccgtcttggcctacagc
agccaggggcccctgcacatgcagccccttcaccaggagttcaacgccgccgtgagggag
gccggccgcacccgggactcctacctcagccacttcaacttcaagaccctgcacttcctc
ctgaccagagcccttcacgtcctgaaggccgccgagcccgcgcggtgccaccaggtgtac
cgcggcgtccggggcatccgcttcaaagccgaaatccgcaagcccgtccggttcggccac
ttcacctccacgtcgctgaagaacgacagcgccctgcggttcgggcaggacaccttcttc
tccatcaagacctgcttcggggccaacatcaagaacttctccttcttccccgacgaggac
gaagtgctgatcccccccttcgagaaattcaaggtcaccaacttcacccaggctcagggc
aggaccatgatccagctgcagtccctggaaagctccagcaaccacaactgcgagtatgtg
aaagagaaaagatgcaagacccgaagatgcgttttcaactctggaatgagcagtttctcc
tccggcccacagcacctgtacctcctcggtggagtccttctgatggccagtgcgttggga
gcacctggcttcctttga

DBGET integrated database retrieval system