KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102456040Help
Entry
102456040         CDS       T02980                                 

Definition
prostaglandin G/H synthase 1-like
Orthology
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102456040
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102456040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 522 aa AA seqDB search
MRVGWEDYECDCTRTGYFGINCTLPEFWTRLRVLLKPSPAVYHFILTHCKWLWDIINTTF
VRDTLMKLVLTVRANLIPSPPTYNSAYGYISWESYANVSYFTRVLPPVPEDCPTPMGTSG
KKQPPNPQLLAEKFLLRRQFQRDPRGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHG
HFTHQFFKTSGKMGPGFTKALGHGRDPRGTNLMFAFFAQHFTHQFFKTSGKMGLSLPPPL
GETIKIVVEEYVQHLSGYFLRLKFDPELLFDVQFQYRNRIAVEFNQLYHWHGLMPDSFVI
QGKEYSYQQFIYNTSMLMDYGVEALVESFSKQIAGKVGGGQSINTHLLKVAVGVIEESRL
LRLQPFNEYRKRFSMKPYKSFQELTGEEEKAAALEELYGDINALEFYPGLLLEKPQPNSM
FGESMVETGAPFSLKGLFGNPICSPEYWKPSTFGGAAGFEIVKTASLQKLVCRNVRRCPF
VSFHVPEDLLPRRYKSALADNCLEETASQLCELDPVNGLSGR
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcggctgggaagactacgaatgtgactgcacccgtactgggtacttcggcatc
aactgcactctgcctgagttttggacgcgactccgcgttttgctcaagccaagcccggcc
gtctatcacttcatcctgactcattgcaagtggctttgggacatcatcaacaccaccttc
gttagggacaccctgatgaaactggtgctcacagtgcgggccaatctgatcccaagcccc
cccacctataactcggcttacggatacatcagctgggagtcctatgccaacgtgagctat
ttcacccgggtccttccacctgtaccggaggactgcccgactcctatgggaaccagcggg
aagaagcagccccccaaccctcagctccttgcggagaagtttctgctccggcggcagttc
cagagagacccccgggggaccaacctgatgttcgccttcttcgcgcagcacttcactcac
cagttcttcaagacgtccgggaagatggggcccggcttcaccaaagccttgggccacggg
cacttcactcaccagttcttcaagacgtccgggaagatggggcccggcttcaccaaagcc
ttgggccacgggagagacccccgggggaccaacctgatgttcgccttcttcgcgcagcac
ttcactcaccagttcttcaagacgtccgggaagatgggcctctcgctgcctcccccccta
ggagagaccatcaagatcgtggtggaggaatacgtgcagcatctcagcgggtacttcctg
cgcctcaagttcgaccccgagctgctgttcgacgtccagttccagtacaggaaccgcatt
gccgtggagttcaaccagctctaccactggcacgggctgatgccggactcgttcgtcatc
cagggcaaggaatacagctaccagcagtttatctacaacacctccatgctcatggactat
ggggtggaggccttggtggagtccttctccaagcaaatagcaggaaaggtcggcgggggc
caaagcatcaacacccacctcttgaaagtggctgttggcgttattgaggaatcgcggctg
ctgaggctgcagccgtttaacgagtaccgcaagcgcttttccatgaagccctacaagtcc
ttccaggagttaacaggagaagaggagaaggcagcggcgctggaagagctctatggagac
attaatgccctggagttttacccgggcttgctgctggagaagccccagccgaactctatg
tttggggagagcatggtggagacgggagcccccttctccctgaaagggctgttcggaaac
cccatttgctccccggaatactggaagcccagcacgttcggcggcgcggctggcttcgag
atcgtaaagacggcgtcgctccagaagctggtgtgtcgcaacgtcaggcggtgtcccttc
gtgtccttccacgtgccagaagacctcctaccccgcaggtacaagtcagccctggcggat
aactgcctggaagagacggcgagccagctttgtgaactggatcccgttaacgggctgagt
gggcgctga

DBGET integrated database retrieval system