KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102456484Help
Entry
102456484         CDS       T02980                                 

Gene name
KAT5
Definition
K(lysine) acetyltransferase 5
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102456484 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
ENSPSIG00000002928
Position
Un
AA seq 523 aa AA seqDB search
MAEVGEVTEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
DRLDLKKIQFPKKEAKTPTKNGLPGSRPSSPEREVRKTLDLSLQPASAPASGKTLPIPVQ
ITLRFNLPKEREAVPGEPDQPLSSSSCVQPNHRTTKRKVEVVSPATPVPASTETTQASVF
PQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIITRMK
NIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYVKSLKCLQRHLTKCDLRHPPG
NEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFH
IVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLG
LLSYRSYWSQTILEILMNLKSENGERPQITINEISEITSIKKEDVISTLQYLNLINYYKG
QYILTLSEDIVDGHERAMLKRILRIDSKCLHFTPKDWSKRGKW
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgggagaggtgaccgagggctgccggctgcccgtgctgcgtcgcaaccag
gataacgaagatgaatggcctctggctgaaatcctcagtgttaaggacatcagcggcagg
aagcttttctacgtacattacattgactttaacaagcgtctggatgaatgggttacccat
gaccggctggacttgaagaagatccagttccccaagaaggaagccaagactcccaccaag
aatgggcttcctggctcccggcccagctctccagagcgggaagtgaggaagaccttggat
ctatctctacaacctgcctcagctccagccagcggtaaaaccctgcccatcccagtgcag
ataacgctccgctttaacctgcctaaggagagggaggctgttcccggggagcctgaccaa
cccctctcctccagctcctgcgtccagccgaaccatcggacaacgaaacggaaggtggag
gtggtttcccctgcaacccccgtccctgcttcgacagagaccactcaagcctctgtgttc
ccccagaacggctcagccaggagagctgtggctgcccagcctggcaggaagaggaaatcc
aactgcctgggcacagatgaggactcccaggacagctcagacggtatcccttcagccccg
cgcatgactggcagcttggtgtcggaccgcagccatgacgacatcatcacgcgcatgaag
aacatagagtgcatcgagctgggccggcaccgcctgaagccctggtacttctcaccctac
ccgcaggagctcaccaccctgcctgtgctgtatctctgcgagttctgcctcaaatatgtc
aagagcctcaagtgcctgcagaggcacctaaccaagtgtgacctacggcacccacctggg
aacgaaatctaccgcaaaggcactatctccttctttgagatcgacgggcgcaagaacaag
agctactcacagaacctctgcctgctggcgaagtgcttcctggaccacaagaccctgtac
tatgacactgaccccttcctcttctatgtcatgacagagtatgactgcaagggcttccac
atcgtgggctatttctccaaggagaaggagtccacagaggactacaatgtggcctgcatc
ctaaccctgcctccataccagaggcgaggctatggcaagctgctcatcgaattcagctat
gagctctccaaggtggaagggaaaacagggacaccagaaaagccactctcagacctgggg
cttctctcctaccgcagttactggtcccagaccatcctggagatcctaatgaacctgaag
tctgagaacggagagcgcccacagatcactatcaatgaaatcagcgagatcaccagcatc
aagaaggaggatgtgatctccacactgcagtatttgaatctcatcaattactacaagggc
cagtacatcctgacactctcagaagacatagtggatgggcatgagagggcaatgctgaag
cggatcctgcgcattgactccaagtgtctgcacttcacccccaaagactggagcaaaagg
gggaagtggtga

DBGET integrated database retrieval system