KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102456858Help
Entry
102456858         CDS       T02980                                 

Gene name
ELP3
Definition
elongator acetyltransferase complex subunit 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102456858 (ELP3)
Transfer RNA biogenesis [BR:pss03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    102456858 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
ENSPSIG00000018220
UniProt: 
Position
Un
AA seq 533 aa AA seqDB search
MMMTIADVIKQLIEAHEQGKDVNLNKVKTKTSAKYGLSAQPRLVDIIAAVPPQYRKVLVP
KLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTS
MRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALPEDYRDYFIRNLHDALS
GHTSNNVSEAVKYSERSLTKCVGITIETRPDYCLKRHLSDMLSYGCTRLEIGVQSVYEDV
ARDTNRGHTVKAVCESFHLAKDAGFKVVAHMMPDLPNMGLERDIDQFVEFFENPAFRPDG
MKLYPTLVIRGTGLYELWKSGRYKSYSPSTLVDLVARILALVPPWTRVYRVQRDIPMPLV
SSGVEHGNLRELALARMKDLGTQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWE
TFLSYEDPEQDILVGLLRLRKCSGESFRPELKGGVSIVRELHVYGSVVPVSSRDPSKFQH
QGFGMLLMEEAERIAKEEHGSWKIAVISGVGTRNYYRKIGYELEGPYMMKRLD
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgacaatagctgatgtcattaagcagctgattgaggctcatgagcagggaaaa
gatgtgaatctaaataaagtgaaaaccaagacatctgctaaatatggactttctgcccag
cctcgtttggttgatatcattgctgctgtaccacctcagtatcgcaaggtgctggtaccc
aagctgaaagcaaagcctatacgtactgctagtgggattgctgttgtggctgtgatgtgc
aaacctcacaggtgtccacacattaactttacaggaaacatatgtgtatactgccctggt
ggacctgattctgattttgaatactcaacacagtcttacactggctatgagccaacgtct
atgagggccattcgtgccagatacgatccttatctccagacaagacatcgagttgaacag
ctgaagcagctgggccacagtgtggataaggtggaattcatcgtgatgggaggaacattt
atggcccttcctgaagactacagagattacttcatccgaaaccttcatgatgctttatct
ggacacacgtccaacaacgtatcggaagctgtcaagtactcagaaagaagcctcacgaag
tgcgttgggatcaccatagagaccaggccggattactgcctgaagcggcacctgagcgac
atgctgtcatacggctgcacaaggctggaaattggagtgcaaagtgtctatgaggatgtg
gccagagataccaacaggggacacacagtgaaggccgtgtgtgagtcatttcacttagcc
aaggatgcaggatttaaagttgtggcgcacatgatgcctgatttgccgaacatggggctt
gaaagagatattgaccagtttgttgagttttttgagaaccctgcttttcgccctgatggc
atgaaactctacccaactctagtgatccgtggcactggcctgtacgagctctggaagtct
ggaagatacaagagttactctccaagcaccttagtggatttggtggctagaattctggct
ctcgtgccgccatggacgcgagtataccgtgttcagagggatatcccaatgccactagtc
agctcaggagtggagcacggtaacctgagagaacttgctttggctcggatgaaggatcta
gggacacagtgccgtgatgtgaggacgagagaggttggaatacaggagattcatcataaa
gtgagaccatatcaggttgagttagttcgaagagactacgtggcaaatggtggctgggag
acttttctgtcctatgaagatccagaacaggatattctggttggccttctgcgtttgcgg
aagtgttcaggggagtcattcaggcctgagttgaagggaggcgtttcaatcgttagagaa
ctgcatgtgtacggtagcgtggtcccagtgagcagtcgtgacccttccaaatttcagcat
cagggatttggtatgttgctaatggaggaagcagaaaggatagccaaagaagagcatgga
tcatggaaaattgcagtcatttcaggagtcggcaccaggaattattacaggaagattggt
tatgagctggaaggaccatatatgatgaaaaggctggactaa

DBGET integrated database retrieval system