KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102456906Help
Entry
102456906         CDS       T02980                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102456906
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102456906
Enzymes [BR:pss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102456906
Exosome [BR:pss04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102456906
  Exosomal proteins of breast milk
   102456906
Heparan sulfate/heparin binding proteins [BR:pss00536]
 Enzymes (General comment) Variety
  102456906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 545 aa AA seqDB search
MAPSVPTVPIAVDKVEVGKASMGAMGYVVAEPYNDGSKPSQVTDVARNRPCGGHHQERGR
PEETTVISTWEGIALMETSQERSTIETKRDFEGIESKFSLRTAHEPDEDICYLVPGQDDT
LARCNFNHTSKTFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVIVVDWLSRAQQHYPV
SAAYTKLVGKDVARFIDWMEEQFSYPLDNLHLLGYSLGAHAAGIAGSLTKNKINRITGLD
PAGPNFEYAEATTRLSPDDADFVDVLHTYTRGSPDRSIGIQKPVGHIDIYPNGGGFQPGC
NLGEALRLIAEKGLGDVDQLVKCSHERSIHLFIDSLLYKDKTNVAYRCNAKETFEKGLCL
SCRKNRCNNLGYTVNKVRAKRNTKMYLKTRSQMPYKVFHYQVKIHFFGKANVTKTNQPFL
VSLYGTASESKNIALVLPEISTNKTSSFLVYTEVNIGDLLMLTLQWEKESIFSWSDWWTS
YTFDIQRVRVKAGETQKKMVFCSRDGISYLRKGKEAAVFVKCMEKPKKRGPGDLEEKSSQ
EYSEE
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggctcccagtgttcccacggtccccattgcggtggataaggtggaggtgggtaaggcc
agtatgggtgccatgggctatgttgtggcggagccctataatgatgggagcaagccttcc
caggtgacggatgtcgcaaggaatagaccgtgcggtggtcatcatcaggaaagggggcgt
cctgaagagacaacggtgatatcgacctgggaggggattgccttgatggagacctcccag
gagagaagcaccatagaaacaaagagagactttgaggggattgagagcaaattctcctta
aggacagctcacgaaccggatgaggacatctgctacttggtccctggtcaggacgacacc
ttggcacgatgcaacttcaaccataccagcaaaacctttgtggtgatccatggatggacg
gtaacagggatgtatgagagctgggtcccaaagctggtggatgctctgtacaagagagaa
cctgattctaacgtcatagttgtagactggctaagtcgtgcccagcaacattatccggtc
tctgctgcctacactaaactggtgggaaaagatgtagcaaggtttatcgactggatggag
gagcaattcagttacccgcttgacaacctgcatttgctgggatatagtcttggggcccat
gctgctgggattgcggggagtctgaccaaaaataagattaacaggatcactggtttagat
ccagctggacctaactttgaatatgccgaagctaccacgcgcctgtccccggacgatgct
gattttgtggatgtcctacacacctacaccagggggtctccagatcgcagcattgggata
caaaagcctgttgggcatattgacatctacccaaatggaggaggtttccagccaggctgt
aacctaggcgaagccctgcgcctgattgcagaaaaaggcctcggagatgtggatcagctg
gtgaaatgctctcacgaacgttctatccacctcttcatcgactccctcttgtacaaagac
aagacaaacgtggcctaccggtgcaacgcaaaggaaacctttgagaaggggttgtgtctc
agctgtcggaagaaccgctgcaacaatctaggctatacggtcaacaaagtgagagccaag
agaaacaccaaaatgtatctgaagactcgctctcaaatgccctacaaagtcttccattac
caggtcaagattcacttttttggaaaggcgaacgtgaccaagacaaatcagccattcctg
gtctctttgtatggcactgcctctgagagcaagaacattgctttggtactacctgaaatt
tccacaaacaaaacctcctctttcctggtttacaccgaggtcaatattggagacctcctc
atgctgacgctgcagtgggagaaagaatccattttcagctggtcggactggtggacctcc
tacactttcgacatccagcgtgtccgagtgaaggcaggagaaactcagaaaaaaatggtg
ttctgctctcgcgatggcatctcttacctcagaaaaggaaaggaggcggcagtgtttgtg
aaatgcatggagaagcccaagaaaagaggcccaggagacctcgaggaaaaatcatcccag
gaatattctgaagaatga

DBGET integrated database retrieval system