KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102457585Help
Entry
102457585         CDS       T02980                                 

Definition
(RefSeq) alkaline phosphatase, tissue-nonspecific isozyme-like
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102457585
Enzymes [BR:pss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102457585
Exosome [BR:pss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102457585
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pss00537]
 Enzymes
  102457585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 503 aa AA seqDB search
MKAPLHLLLLAEVCLASLVPGERSWRLVPPAPGLETAERRAAGMGAGLAGLAGARAEVRV
SAPRFFSLGHLSLAPCDPLSAAGMGVSTITAARILKGQLQNKMGEEXYVALSKTYNTNAQ
VPDSAGTATAYLCGVKANEGTVGVSAAVTRAQCNTTAGNEVTSILKWAKEAGKSVGIVTT
TRVNHATPSAAYAHSANRDWYSDSEMPPEAIQQGCKDLAQQLVENIPDMEVILGGGRKYM
FPKNTSDVEYPSEDKHQGTRLDGQNLVDVWRAKKPKDKHTRYVWNRTELLALDPKDVDFL
LGLFEPMDMMYELDRDAETDPSLTEMVQVALKILQRNPRGFFLLVEGESLAPMQSDGDKK
PLTPPPRLTLLLPPGLAPMHSDVDKMPFTAILYGNGPGYKVVSGERENVSAVDYAHANYQ
AQSAVPLRQETHGGEDVAIFAKGPMAHLLHGVREQNYIPHAMAYAACIGQNTGHCRSGAH
HSTAGLLPCLSTLAPLLLLQLWF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctccgctccatctgctgctgctggctgaagtgtgtctggcgtcccttgtccca
ggtgagcggagctggagactcgtgcccccggcacctgggctggagacagctgagaggagg
gctgctggcatgggggcggggctggctggccttgcaggcgctcgtgcggaggtccgagtg
agtgctccacgattcttcagcctcggacacctctcacttgcaccctgtgatcctttgtct
gcggcaggcatgggcgtgtccacgatcacggcggctcggatcctcaaggggcagctgcag
aacaagatgggggaagaancatatgtggctctatctaagacctacaacaccaacgcccaa
gtgccggacagtgccgggacggccacggcgtatctctgcggggtgaaggccaacgagggg
acggtgggggtaagcgcggccgtgacccgcgcccagtgcaataccacggccggcaacgag
gtcacgtccatcctcaagtgggcgaaggaagccggcaagtccgtgggcatcgtcaccacc
acgcgggtgaaccacgccacccccagcgccgcctatgcccactctgccaacagggactgg
tactcagacagcgagatgcccccggaggccatccagcagggctgcaaagatctcgcccag
cagctggtggaaaacatcccggacatggaggtgatcttgggcgggggccggaaatacatg
ttccccaagaacaccagtgacgtggaataccccagtgaggacaagcaccagggcacccgc
ctggatggccaaaacctcgttgatgtctggagagcgaagaagcccaaagacaagcacacc
cggtacgtgtggaatcgcacagagctcctggcgctggacccgaaggacgtggacttcctc
ctaggcctcttcgagcccatggacatgatgtacgagctggacagggacgctgagacagac
ccgtccctgacggagatggtgcaggtggccctcaaaatcctccagagaaacccccgaggg
ttcttcctgctggtggaaggtgagagtctagcgccgatgcagagcgacggggataaaaag
cccctcacccccccccccaggctcacccttctgctccccccaggtctagcacccatgcac
agcgacgtggataaaatgcccttcaccgccatcctctacggaaacggccccgggtacaaa
gtggtgtccggcgagagggagaacgtgtcggccgtggattacgctcatgccaactaccag
gcccagtcggccgtgcccctgcgccaggagacccacggcggggaggacgtggcgatcttt
gccaagggccccatggcccacctcctgcatggtgtgcgggagcagaactacatcccccac
gccatggcctacgcggcctgcatcggtcagaacacaggccactgccgctcaggggcccac
cacagcacagcggggctgctgccctgcctctccaccctcgcccccctcctcctcctccaa
ctctggttttaa

DBGET integrated database retrieval system