KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102457690Help
Entry
102457690         CDS       T02980                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102457690 (MGLL)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102457690 (MGLL)
Peptidases [BR:pss01002]
 Serine Peptidases
  Family S33
   102457690 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 303 aa AA seqDB search
MPEDNSPRRSPQNIPYQDLPHMVNADGQYLFCRYWKPAGTPRALVFIVHGAGEHCGRYDD
LAQMLTGLNLFVFAHDHVGHGQSEGDRMVVSDFHIFIRDSLQHIELMKKDHPDLPVFILG
HSMGGAISILTACEKPDEFSGMVLISPLVVASPEAATPIKVFAAKVLNLVLPNLTLGAID
PNVVSRNKKEVESYTSDPLVYHGGMKVSFVIQLMNAIAKIERSLPKLTLPVLVLHGSLDK
LCDIKGSYLLMDTVQSQDKTLKVYDEAYHALHRELPEVSTAVFQEILTWIGQKVSADGGP
SHT
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggataattccccaagacggagtcctcagaatatcccttatcaggaccttcct
catatggtcaatgcagatggacaatatcttttctgcagatattggaaaccagccgggact
ccaagggccctcgtgtttatcgttcatggcgctggggaacactgcggccgctatgatgac
ttagcccagatgctgacaggacttaacttgtttgtatttgctcatgaccatgttggccat
gggcagagtgaaggtgaccgcatggttgtgtcagatttccacattttcatcagagacagc
ttgcaacacattgaactcatgaaaaaggatcatccagaccttccagtttttattctgggg
cattccatgggaggagccatctccatcttgactgcctgcgagaaaccagacgagttttca
ggcatggtgttaatttctcctttagttgtagcaagcccagaggccgcaacgcctatcaag
gtgtttgcagctaaagtgctcaacttggttctaccaaacctgacactgggagcgatagac
ccaaatgtggtttcccggaacaaaaaggaggttgaatcttacacctctgaccccctggtc
taccatgggggcatgaaggtctcctttgtcatccagctgatgaacgccattgccaaaata
gagcgatccctgcctaaactgactctgccagtcctggtgctacatggttcgctcgacaaa
ctctgtgacatcaaaggctcctacttactgatggacaccgtgcagagtcaggacaaaaca
ctcaaggtgtatgatgaggcctatcatgctctccatagagagctgccagaagtcagcact
gctgtgtttcaggaaatactaacatggattggtcagaaggtctcagcagatggaggacca
agccacacttaa

DBGET integrated database retrieval system