KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102458351Help
Entry
102458351         CDS       T02980                                 

Gene name
NCOA1
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102458351 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
ENSPSIG00000007514
Position
Un
AA seq 1440 aa AA seqDB search
MSGLGDSSTDPANPDSRKRKGSPCDTLAQSNEKRRREQENKYLEELAELLSANIGDIDTL
SVKPDKCKILKKTVDQIQQMKRLEQEKTADDDVQKSDISSSSQGVIEKESLGPLLLEALD
GFFFVVNREGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGV
PWPQEATRRSSHTFSCRMLIRPPDEPGTENQEARQRYEVMQCFTVSQPKSIKEEGEDFQS
CLICIARRLPRPAAVTSSESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQ
PQGREPSYAKQLFQEVMTRGTAFSPSYRFTLSDGTVLSAHTKCKLCYPQSPEVQPFIMGI
HIIERDHHMLSPQENTNSGMSLPRVSPALNPGISPAQGLALPSAIPPSNSSMLATNINQQ
PGSGLHGSSSSTGQPSFGCSPGNQIGANVALSQGQAGPQNNSHLLNLSSSPLNSPGITSA
QFMSARHRGSPGLVPRPRVASHPFSPTMPTMHSPVGMASGGCSSGGSSNRPFPGAPINSM
QGLNEGPSTPMGYSTPPPILRPPSSQNSPGRLSMQPVKTEPKDSKEIASILSEMIQSDGG
SSDSKPLDSGLLHASDRLSEGDTKCSQATSHKLVQLLATTAEQQLRHADADTSCKDPLSC
TGASGNPPGNACPSSHSSLTERHKILHRLLQEGSPSDITTLSMEQDKKDTAATPTAQSQI
PGGPEIKLEPEALKKKESKDHQLLRYLLDKDEKDLAVVPSLSLDDVKVKVEKTEQMDPCN
TTPAPLTKPPAAEEVKLESQDQIAADLDQLDQLLPSLEKVSQLPGLCGTDRTESSMAGVA
VKPEILTAPLQPSAAARTPMGLNRLSELELGVSDQQFGQPGMGDQIQWTDNTMASMNRAP
LNKPDDQCITSQLDDLLCPPTTPEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLEVLNDRFQTQQVTPSLLMDQKPGLYPQPYSSASPSANLPSSFPGMVRQKPSFGP
MPVQVAPPRGAFPTNLGMQPRQTLTRPPTAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AANSPVGISMRAGMQPQITPQPPLNAQMLAQRQRELYSQQHRQRQLMQQRAILMRQQSFG
NNLPPSAGLPVQMAAARLPQAPPQQFPYPPNYGTNPGNPPTSTSPFSQLALNAEAALANR
NSMVNRGMMGNVGGQFGAGMSPAMQQNMFQYSGSGMGQQSEPAFAPSLSPSSPLMSPQIP
PSQSPMLQSAPPAPGYQSPDMKTWQQGTMGNNNVFSQAGQNQPTPAQQGMYNNMSITVSM
AGGNTNVQNMNPMTGQMQMSSLQMPGMNSMCSEQVNDSALRPSGLYCNQLSSTDLLKTEA
DGAQQVQQVQVFADVQCTVNLVGGDPYLNQPGPMGSQKSTTGPQTPQAQQKSLLQQLLTE
NT seq 4323 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggatagttcaacagaccctgctaaccctgattcccggaagaggaag
gggtcgccctgtgatacattggcccagagcaacgaaaagcgacgccgggagcaggagaac
aaatacttagaggagctggcggagttgctgtcggcaaacattggggacattgacaccctg
agtgtcaaaccagacaaatgcaagattctaaagaagacggttgaccagatccagcagatg
aagagactggaacaagagaaaacagctgatgatgacgtccagaagtctgacatctcatcc
agcagccaaggagtgattgaaaaggaatcactgggaccccttctcctggaagcactggat
ggctttttcttcgttgtgaatcgtgaggggaggattgtgtttgtgtcagaaaatgtgacc
agctacctgggttataaccaggaggagctcatgaataccagtgtctacagcatcctgcat
gtaggggatcatgcggagttcgtcaaaaatttgctgccaaagtctctcgtgaatggagtt
ccctggcctcaggaagcaaccagacgcagcagccataccttcagctgccggatgctgatc
cgcccccctgacgagccagggacggagaaccaggaggctcgccagcgctatgaggtgatg
cagtgcttcaccgtatcccagcccaaatcgatcaaagaggaaggagaagatttccagtcc
tgtctcatatgcattgcacggagattacctcgacctgcagctgtcaccagttcagaatct
ttcatgaccaagcaagatactacaggtaaaattatctccattgacaccagttccctcaga
gctgcaggcaggactggctgggaggatttagtgcggaagtgcatctatgctttcttccag
cctcagggcagagagccgtcttatgccaaacaactgtttcaagaagtgatgacacgtggc
acggccttcagcccgtcgtacaggttcacgctgagcgacgggacggtgcttagcgcccac
accaagtgtaagctctgctatcctcaaagcccagaagtgcagcctttcattatgggcatc
cacatcattgagagggatcaccacatgctctctcctcaggagaacactaactctggaatg
tccctcccccgggtcagccccgcactgaatcccggcatctccccagcgcaaggcttggct
ctcccatccgccatccctccatccaacagcagcatgttggcgaccaatataaatcagcag
ccaggctccggcctccacggcagcagttccagcaccggccagccaagcttcggatgttca
cctgggaatcagattggagccaatgttgccttaagccagggacaagctggcccccagaac
aatagtcacctcttaaacctcagtagctccccgctcaatagccccgggatcacctcagca
cagttcatgtctgctcggcaccggggcagcccagggttggtaccgaggcccagagtggca
agccatcctttctctccgacgatgcctaccatgcactcccccgtgggcatggcgagcggt
ggctgcagcagcggtggcagcagcaacaggcctttccccggtgccccgataaactctatg
caggggcttaatgaaggccccagcacccccatgggctactccacaccacctcccattctg
aggccaccgagctcccagaactcgcccggccggctcagcatgcagcctgtgaaaacggag
cccaaagacagcaaggagattgcctccatcctgagcgagatgattcagtctgacggcggc
tcaagcgacagcaagcccctggactcaggcctgctgcatgccagtgacagactctcggag
ggagacaccaagtgctcccaggccaccagtcacaagctggttcagctcctggccacgacg
gcggagcaacagctgcggcacgccgatgcagacacgagctgcaaagaccccttatcctgc
acgggtgcctctgggaaccctccgggcaatgcgtgtccctcttcccacagctccctcaca
gagcggcacaagatcttacatcggctcttgcaggagggcagcccctccgacatcaccacc
ctgtccatggagcaagacaagaaggacactgctgccacccctactgctcagagtcagatc
ccagggggccctgaaatcaaattggagccagaggccttgaagaaaaaggagtccaaggac
catcagctcctgcgctacctactagacaaggatgagaaggaccttgctgtggtcccgtcc
ctgagtctggatgatgtgaaggtgaaagtggagaaaacggagcaaatggacccgtgcaat
acgactccagcccctctgaccaagccccctgctgcagaggaagtcaagttagaatcgcag
gaccagattgctgctgacctcgaccagctcgatcagctgctgccttcgctggagaaagta
tcccagttgccaggcttgtgtgggacggatagaaccgaaagcagcatggccggtgttgcg
gtgaaacccgagatcctgaccgcccccctccaacccagcgctgcagcaagaactcccatg
gggcttaacagattgtctgaactggagttgggagtctcagatcaacagtttggacagccc
ggaatgggtgaccagattcagtggacagacaacaccatggcctccatgaatcgagcacct
ttgaataaaccagacgaccagtgcatcacttcccagctggacgatttgctgtgccctccc
accacgccggagggccggaacgacgagaaagccctcctcgagcagctcgtgtccttcctg
agcggcaaagatgaaacggagctggcggaattggaccgggcactcgggattgacaaactg
gttcagggaggcggcctggaagtgctgaatgacagattccagacacagcaagtgacaccg
tctcttctcatggaccagaagcctggcctgtacccccagccttactcctctgcttctcct
tcggctaatctccccagctcgttcccaggcatggtcaggcagaaaccttctttcgggccc
atgccagtccaagtagcaccaccccgaggggccttccccaccaacctgggaatgcagcca
cggcagactctgaccaggcccccaacggcgcccaaccaactgagacttcagctgcagcag
cggctacaagggcagcagcagctgatacaccagaatcggcaggctatcctgaaccagttt
gcagcaaattctccggttggcatcagcatgagggcaggcatgcagccgcagattacacct
cagccacctctgaatgcacagatgctggcccagcgccagcgagagctgtacagccagcag
catcggcaaaggcagctaatgcagcagcgagccatcttaatgagacagcagagcttcggg
aacaacctccctccctcggctggactcccagtgcaaatggcagcagctcgcctcccccag
gcacccccacagcagttcccctatccccccaactacggtacgaatccaggaaaccctccc
acctccaccagccccttttcacagctggcattgaatgcggaggcagccctggccaatcgc
aacagcatggtgaacagagggatgatggggaacgttggggggcagttcggtgccgggatg
agccctgcgatgcagcagaacatgttccagtactctgggtcaggcatgggtcagcaaagt
gagcctgcattcgctccctcactcagccccagcagccctctgatgtcgccgcagattccg
ccttcgcagagccccatgctccagtcagcccccccagcacctgggtaccagtccccagac
atgaagacttggcagcaaggaacaatggggaataataatgtattcagtcaagctgggcag
aaccagcccacacctgcacagcagggaatgtacaacaacatgagcatcaccgtgtccatg
gccggaggcaacacgaatgtccagaacatgaacccgatgacgggacagatgcagatgagc
tcactgcaaatgcccgggatgaactccatgtgctccgagcaggtaaatgactcagcgctg
agaccctccggcctttactgcaaccaactttcctccactgaccttttgaaaacagaagct
gatggggcgcagcaggtacaacaggttcaggtgtttgctgacgtgcagtgtacagtgaat
ctggtaggcggagacccttacctgaaccagcctggtccaatgggctcgcagaaaagcacg
acaggtcctcagacccctcaggcccagcagaagagcctccttcagcagctactgactgaa
taa

DBGET integrated database retrieval system