KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102458536Help
Entry
102458536         CDS       T02980                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase 3
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    102458536
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     102458536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 102458536
NCBI-ProteinID: XP_006127764
Ensembl: ENSPSIG00000010316
Position
Un
AA seq 278 aa AA seqDB search
MSFFRKPRPAITLEDPEVKYPLRLIDKEDISHDTRRFRFALPTREHVLGLPIGQHIYLSA
RIDGNLVIRPYTPVSSDDDKGYVDLVVKIYFKGVHPKFPNGGKMSQYLDNLKLGETIDFR
GPSGLLVYKGKGKFAIRAEKKAEPVLKTVKYVGMIAGGTGITPMLQLIRAIMKDKDDPTT
CQLLFANQTEKDILLREELEEVKVEHPDRFKFWYTLDRAPENWEYSEGFVNQDMFREHLP
PPQDDVLILMCGPPPMIQYACIPNLEKLGYTKNMTFSY
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagtttctttaggaaacctcgtcctgcaattaccctggaggaccctgaagtgaaatac
ccattaaggctgattgacaaagaggacattagtcacgacacgagaagatttcgctttgcc
ctgccaactcgagaacatgttttaggtctccctatcggacagcatatttatctttcagca
cggattgacgggaatctagttatcagaccctatacaccagtctccagtgatgatgacaaa
ggctatgtggatctcgttgttaagatttatttcaaaggggtccatccaaagttccccaat
ggagggaagatgtctcaatatttagacaacctgaaacttggggaaaccattgatttcaga
ggacccagtggattacttgtctataagggaaaaggcaagtttgccattcgtgctgagaag
aaagccgaacctgttcttaaaacagtgaaatatgttggcatgattgcaggtggaactggc
ataacacctatgttgcagcttattcgtgccatcatgaaggacaaagatgatcccaccact
tgccagctgttgtttgctaatcagactgagaaagatatcctgttacgtgaagaactggag
gaagtcaaggttgagcatccagatcgctttaagttttggtacacgttggacagagcacct
gagaattgggagtacagcgagggatttgtgaaccaagacatgttccgtgaacacctgccc
ccgcctcaagatgatgttctgatcctcatgtgtggccctcctccaatgatccagtatgct
tgcattcccaacctggaaaaactgggatacaccaagaacatgacattctcctactaa

DBGET integrated database retrieval system