KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102459102Help
Entry
102459102         CDS       T02980                                 

Gene name
PTGS2
Definition
prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
Orthology
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Arachidonic acid metabolism
Metabolic pathways
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102459102 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    102459102 (PTGS2)
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102459102 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
ENSPSIG00000009768
UniProt: 
Position
Un
AA seq 658 aa AA seqDB search
MQSSERWPQNRSLSTGSSSSNSGSFSSPGSDRPRQRQHLTSSRRATPACEEPRAMIVSCA
LVLALLRVGQAANPCCSNPCQNRGECMTIGFDRYECDCTRTGFYGENCTTPEFLTWLKLT
LKPTPNTVHYILTHFKGVWNIINSIPFFRDSIMKYVLTSRSHLIDSPPTYNSQYHYKNWE
AYSNLSFYTRALPPVSPDCPTPMGVKGKKELPDSTMVVEKFLLRQKFIPDPQGSNVMFTF
FAQHFTHQYFKTDHRRGPAFTKALGHGVDLSHIYGETLERQLKLRLLKDGKLKFQMINGE
MYPPTVKDTQAEMIYPPHIPEHLRFSVGQEVFGLVPGLMMYATIWLREHNRVCDILKQVH
PEWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIAAE
FNTLYHWHPLLPDSFHVHDQEYTFEQFLYNNSIMVEHGLSHMVKSFSKQIAGRVAGGKNV
PFAVKKVAKASIDQSRQMRYQSLNEYRKRFLLKPFKSFEELTGEKEMAAELEELYGDIDA
MELYPGLLVERPRPGAIFGETMVELGAPFSLKGLMGNAICSPQYWKPSTFGGKVGFEIIN
TASLQKLICNNVKGCPITAFHVLNSEATEKATINISSSSSTIEDINPTLLMKERSAEL
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcagcgagcgctggccgcagaacagatccttgagcacgggcagcagcagcagc
aactccggctccttctcctccccgggaagtgaccggccccgccagcgccagcacctgacc
agctctcggcgtgcgactcccgcctgcgaagaaccgcgggctatgattgtgtcctgcgcg
ctagtcctggcgctcctgcgcgtcggccaagcagctaatccttgctgttcaaacccatgt
cagaacagaggagagtgtatgacgataggttttgaccgatatgaatgtgactgtacaagg
acaggattttatggggaaaattgtactacaccggaattcttgacctggttgaaactgaca
ttgaaacctactccaaacactgtccactacatcctcactcatttcaaaggcgtctggaat
ataataaatagcattcccttcttccgtgattccatcatgaaatatgtattgacatcaagg
tcacatttgattgacagtccaccaacatacaacagccagtatcattacaaaaactgggaa
gcctattccaacctttccttctacactagagcccttccaccagtgtcaccagattgccca
acacccatgggtgttaaaggtaagaaggagctcccagattccacaatggttgtggagaaa
tttctgctgagacaaaaatttattcccgacccacaaggctcaaatgttatgttcacgttt
tttgctcaacatttcacccaccagtactttaagacagatcaccgcagagggccagccttc
accaaagctcttggccatggggttgacttgagccacatctacggagagactttggagaga
cagcttaagttgcggctacttaaggatggaaagctaaagtttcagatgattaatggagaa
atgtaccctcccactgtgaaggacacacaagcagaaatgatctaccctcctcatattcct
gagcacctgcgattttctgtaggccaggaggtgtttggtttggtcccaggtttaatgatg
tatgccacaatatggctcagagagcataaccgagtctgtgacatccttaagcaggtgcat
ccagagtgggatgatgagcagctgttccaaactaccagactcatattgataggagagacc
atcaagattgtcattgaagactatgtgcagcacttgagtggctaccacttcaagctgaag
tttgatcctgaacttctgtttaaccaacaatttcaatatcagaatcgaattgcagctgaa
ttcaacacactgtaccactggcacccactcctccctgacagctttcacgtccatgaccag
gagtacactttcgagcagtttctctacaacaactccatcatggtggaacatggcctttct
cacatggtgaaatccttctccaagcaaattgctggcagggttgctgggggtaagaacgtt
ccttttgcagtaaagaaagtagccaaggcttcaattgaccaaagcaggcagatgagatac
caatccttgaatgagtaccgaaaacgcttcctactgaaacctttcaagtcatttgaggaa
cttacaggagaaaaagaaatggcagctgaattagaagagctttatggagacattgatgct
atggagctgtaccctggccttctagtagagaggcctcgtcctggtgccatttttggtgag
accatggtggaacttggcgcaccattctctttgaaaggccttatgggaaatgctatttgt
tctcctcagtactggaagcctagcacctttggtggaaaagtgggctttgaaataatcaat
actgcctcgctacaaaagctcatctgcaataatgtgaagggttgtcccatcactgccttc
catgtcctaaactctgaggccacagaaaaggccaccattaatatcagttcctcaagctcc
acaatagaggatatcaaccccacgttattaatgaaagagagatccgctgaactgtag

DBGET integrated database retrieval system