KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102459270Help
Entry
102459270         CDS       T02980                                 

Gene name
DHCR7
Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Steroid biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    102459270 (DHCR7)
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     102459270 (DHCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
ENSPSIG00000016888
UniProt: 
Position
Un
AA seq 475 aa AA seqDB search
MAAFPEGKSSEERKHKSIPNGSGTSQGQWGRAWEVDWFSLASVLFLLMFSPLIVYYFIMS
CDQYHCSLTDPIIDMLTGNSHLSDIWNKTPSLSWKAANIYIFWVTFQVVLYIFVPDFCHK
FVPGYVGGVQEGSLTPAGTVNKYEINGLQAWIITHALWFANAYYFHWFSPTIIFDNWIPL
LWCANILGYSVSTFAMIKSYFFPSNAKDCKFTSSLFYDYMMGIEFNPRIGKWFDFKLFFN
GRPGIVAWTLINYSYAAKQQELYGQVTNSMILVNVLQGIYVLDFFWNEAWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTANAVGILLLGLVGYYIFRMTNHQKDL
FRRTDGNCKIWGKKPEYIECSYTSVDGTKYYSKLMISGFWGVARHFNYTGDLMGSLAYCL
TCGFGHILPYFYIIYMTILLTHRCIRDEHRCSSKYGKDWKRYTTVVPYRLIPGVF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctttcctgaaggaaaatcttctgaagaaaggaaacataagagcatcccaaat
ggttctgggacctctcaaggccaatggggaagagcctgggaagtagactggttttccttg
gccagtgtccttttcttgcttatgttttctccactcatcgtatattactttataatgtcg
tgtgatcagtaccactgctctctgacggatcccatcattgacatgctcacagggaattcc
cacctctccgacatctggaacaaaacaccatccctgagctggaaagctgctaacatctat
attttttgggtcactttccaggtagtattatatatattcgttcctgatttctgccacaag
tttgtacctggatatgtaggaggagtacaagaaggctctctgacccctgctggcacagta
aacaaatatgaaatcaatggacttcaagcttggatcattacccatgctctctggttcgca
aatgcttactacttccactggttctcacccaccattatttttgacaactggattcctctc
ctgtggtgtgctaatattctgggatactccgtttccacatttgcaatgattaaaagctac
ttttttccaagtaatgccaaagactgcaaattcaccagcagcttattttatgactatatg
atggggattgaatttaaccctcgaatagggaagtggtttgatttcaagctgtttttcaat
ggccggccaggtattgtagcctggactctaattaactattcctacgctgctaaacaacag
gaactgtatggtcaagtgaccaactcaatgatccttgtcaatgtcctacagggtatttat
gttttggacttcttctggaatgaagcttggtatttgaaaactattgatatctgccatgat
cattttggatggtacctgggctggggagactgtgtttggctgccttacctctacactttg
cagggtttatatctggtttaccatcctgtacagctctcaacagctaatgctgttgggatc
ctgctgttggggctggttggctattatatcttcaggatgaccaaccaccaaaaagatctc
ttccgtcgcacagatggaaactgcaaaatctggggtaagaagccggaatacattgaatgc
tcctacacatcagtggatgggacaaaatactacagcaagctgatgatctcaggattctgg
ggagtggcacgtcactttaattacactggtgacctgatgggctccctagcatattgtctg
acttgtggctttgggcacatcctgccttatttctacataatttacatgaccattctgctg
acccaccgctgcatcagagatgaacaccgttgctccagcaaatatggcaaggactggaag
cgctatactactgtagttccttaccgactaataccaggagtattttaa

DBGET integrated database retrieval system