KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102459577Help
Entry
102459577         CDS       T02980                                 

Gene name
PIK3CD
Definition
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit delta
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102459577 (PIK3CD)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    102459577 (PIK3CD)
   04370 VEGF signaling pathway
    102459577 (PIK3CD)
   04630 Jak-STAT signaling pathway
    102459577 (PIK3CD)
   04068 FoxO signaling pathway
    102459577 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    102459577 (PIK3CD)
   04150 mTOR signaling pathway
    102459577 (PIK3CD)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    102459577 (PIK3CD)
  Cell growth and death
   04210 Apoptosis
    102459577 (PIK3CD)
  Cellular commiunity
   04510 Focal adhesion
    102459577 (PIK3CD)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    102459577 (PIK3CD)
  Endocrine system
   04910 Insulin signaling pathway
    102459577 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    102459577 (PIK3CD)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102459577 (PIK3CD)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102459577 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
ENSPSIG00000004597
Position
Un
AA seq 1044 aa AA seqDB search
MPPGIYCPVEFWSKEGNQNIQVDFLLPTGIYLNLSVSCHASLGTIKQVVWHHAQYEPLYH
MLNDPEAYVFTCINQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRAKKLINSQISLL
IGKGLHEFDSMRDPEVNDFRAKMRQFCEERAGKRQQLSWRAWLEYSFPLQLEPLTKSPRT
SPLHVSNRSCFINVKFESGEESFTFQISPMEFPITLISYAIKKQATVFRHQRLESSEDYT
LQVKGKWEYIYGNYPLYQFQYIHSCLHQGILPHLTMVHSSSIIAMRDEQTNCTAHTPKMA
AKPPPIPKKKPTHATLWSLDQPFYIELVQGSKVNADERMKLVVQAGLFHGNEMLCKMVSS
SEVNVCSEPVWKQKLDFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPLAW
VNIMLFDYKDQLKTGECCLHMWSSFPDEKGELLKPMGTSNPNTESAAALVICFPNVASHP
VYYPSFEQLLDLGRSGDYARSTLEDPEEKQQLMEILERRNYTELYEHEKDLVWKMRHEIR
DQYPEALAKLLIITKWNKHEDVAQMITLLQNWPELPVLNALELLDFSFPDRYVGSFTINS
LKKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPA
VALRFGLILEAYCRGSNYHMGILMKQGEALNKMKALNNLIKVSSQKATKLQAKEMMHQCM
KQETYLEALSNFQCPLNPSIILAEICVDQCTFMDSKMKPLWIVFNSDEESGAGVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDKTGLIEVVMRSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALEQAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRETGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGRTNNSEKFERFRDYC
EKAYMILRRHGLLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKTDEEALKQFRLKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgcccccgggcatctattgccctgtggaattctggtccaaggaaggaaaccaaaacatc
caggtggatttcctgctacctacaggcatatacctgaacctctctgtgtcctgccatgcc
agcttgggcaccatcaagcaggtggtctggcatcacgcacagtatgagccgttgtatcac
atgctcaatgaccccgaagcctacgtcttcacgtgtatcaaccagacagccgagcagcag
gagctggaggatgagcagcggcgcctctgtgacatccagccctttctgcccgtcctccgg
cttgtggcccgtgaaggtgacagagccaagaagctgattaactcccagatcagtctgctc
attgggaaaggtttgcatgagtttgattcgatgcgtgacccggaggtgaatgacttccgt
gcaaaaatgcgccagttctgcgaggagagagcggggaagcggcagcagctgagctggagg
gcctggttggaatacagctttcctctgcaactggagcccctgaccaaaagccccaggacc
agcccccttcacgtctccaacaggagctgcttcatcaacgtcaagtttgagtctggcgag
gagagcttcaccttccagatctcccccatggaattcccgatcacattaataagctatgcc
atcaagaagcaagctacagtcttccgccaccagagactggagagctctgaggattatact
ctgcaggtgaaagggaaatgggaatatatctacgggaactaccccctgtaccagttccag
tacatccacagctgcctgcaccaaggtatattgccccacctgacgatggtgcactcctct
tccatcattgccatgcgggacgaacagaccaactgcaccgcccacaccccaaagatggct
gccaagcctcccccgatccccaagaaaaagccaacccatgcgaccctctggtcccttgac
cagcctttttacattgaactggtgcaaggcagtaaagtgaatgcagatgagagaatgaag
ttggtggtgcaggcaggtcttttccatggcaacgagatgctctgcaagatggtgtcgagc
tccgaagtgaatgtgtgttcagagccggtgtggaaacagaagctggattttgacattaac
atctgtgacctgccccgcatggcgcggctctgttttgccctctacgctgtcatcgaaaag
gccaagaaggcgcgatccaccaagaagaaatccaagaaagctgactgcccattagcctgg
gtgaatatcatgctctttgactacaaggaccagctgaaaacaggagagtgctgcctgcac
atgtggtcctcatttccagatgagaaaggggagctgctgaaacccatgggcacaagcaac
cccaacacggagagcgcagcagccttggtcatctgcttccccaatgtcgcatcccaccct
gtgtattacccatccttcgagcagctgttggatctggggaggagcggagactatgcccgc
tctacactagaggacccagaggagaagcagcagctgatggagatcctggagcggaggaac
tacaccgaactctacgagcatgagaaggaccttgtgtggaagatgaggcacgagatccgg
gaccagtatccagaggccttggcaaagctcctcattatcaccaagtggaataaacatgag
gacgttgcacagatgatcaccctgctccagaattggccagagttgcctgtcctgaatgca
ctggagttactggattttagcttccctgatcgttatgttggttcctttactatcaactcc
ttaaaaaagttgacggatgacgaattgttccaatatctgctgcagcttgtccaggtgctc
aagtatgaatcctacttagactgtgaattaaccaagttcctattggacagagcattagcc
aatcgcaaaataggacactttctgttttggcatctcaggtcggaaatgcatgtccctgca
gtcgccctcaggtttggcctgattttggaggcctattgcagagggagcaactaccacatg
ggaattctaatgaagcagggggaagcactaaacaaaatgaaagccttgaacaacttgatt
aaagtgagttctcagaaggccaccaaactgcaagccaaggagatgatgcaccagtgcatg
aagcaggagacctatcttgaggcgctttccaatttccagtgccccctgaaccccagcatt
attcttgctgaaatttgtgtggatcagtgcactttcatggactccaagatgaagccactg
tggattgtatttaacagtgatgaagagagtggagcgggagtgggcatcattttcaaaaat
ggagacgatctccgtcaggacatgctgactctgcagatgatccagctgatggatgtactg
tggaagcaggaaggtttggatctgaggatgaccccttacggctgcctctccacaggcgac
aagactgggctgatcgaagtcgtgatgcgctcggacaccattgccaacatccagctgaac
aagagcaacatggcagccactgccgccttcaacaaggatgcgctgctgaactggctcaaa
tccaagaacccgggtgaagctctagaacaagccattgaggagttcacgctttcctgcgct
gggtactgtgtggcaacgtacgtgctaggcataggggaccggcacagtgacaacataatg
atccgggaaactggccagctgtttcatattgattttggccacttcttggggaacttcaag
accaaatttggtattaacagagaacgggtcccttttatcttaacctacgactttgtgcat
gtgatccagcaagggcgcactaacaatagtgagaagtttgaaagattcagagattactgt
gaaaaagcctacatgatcctgaggcgccatggtcttctcttcctgcatttgtttgcactg
atgaaagctgctggtctgccggaactcagctgctctaaagacattcagtatctcaaggat
tctctagcattaggaaaaacagatgaggaagctttgaagcaattcagactaaaatttaac
gaagccctgcgagagagctggaaaaccaaagtgaactggttggcacacaacgtatccaaa
gataacaggcagtag

DBGET integrated database retrieval system