KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102459880Help
Entry
102459880         CDS       T02980                                 

Gene name
UCHL5
Definition
(RefSeq) ubiquitin C-terminal hydrolase L5
  KO
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102459880 (UCHL5)
Peptidases [BR:pss01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102459880 (UCHL5)
Ubiquitin system [BR:pss04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    102459880 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 316 aa AA seqDB search
MSDSYNCSFALSGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSR
LDTIFFAKQVINNACATQAIVSVLLNCIHQDIHLGDTLSEFKEFSQSFDAAMKGLALSNS
EVIRQVHNSFARQQMFEFDAKSSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQ
DDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKITELQQQLSEEEPMDTDQS
SNMLSSIQSEVAKYQMLIEEENQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLV
EKAKEKQNAKKAQEAK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatagttacaactgtagttttgctctttcaggttgcaggggagcacaggttgaa
gaaatatggagtctggagccagaaaactttgaaaaattaaaaccagttcatgggctgatc
ttcctcttcaaatggcagccaggagaagagccagctggttctgttgttcaggattccaga
ctagacacaatattttttgctaaacaggtaataaacaatgcttgcgctactcaagccata
gtaagtgtgctattaaactgtatccatcaagatatccatctgggagacacactgtcagaa
tttaaagaattttcacaaagttttgatgctgcgatgaaaggtttggcactaagcaactct
gaagtgattcggcaagttcacaacagttttgccagacaacaaatgtttgagtttgatgca
aagtcatcagcaaaagaagaagatgcatttcacttcgtaagctatgttcctgttaatgga
aggctatatgagctagatggattaagggaaggaccaattgatttaggtgcctgtaatcaa
gatgattggatcagtgctgtcaggcctgttatagagaaacgaatacaaaaatacagtgaa
ggggagataagatttaaccttatggccattgtgtctgacagaaaaatgatatatgagcag
aaaataacagaattacagcagcaactttcagaggaagagcccatggatacagaccagagt
agtaatatgttaagttctattcagtcagaagttgcaaaatatcagatgttaattgaagaa
gagaaccaaaaactaaaaagatacaagattgaaaatattagaagaaaacataactacctg
cctttcatcatggaattgttaaaaactttagcagaacaccaacagttaataccactggta
gaaaaggcaaaagagaaacagaatgccaagaaagctcaggaggcgaagtga

DBGET integrated database retrieval system