KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102460423Help
Entry
102460423         CDS       T02980                                 

Gene name
AMY2A
Definition
amylase, alpha 2A (pancreatic)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102460423 (AMY2A)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102460423 (AMY2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 549 aa AA seqDB search
MLKIVGLFKSVICTMYFTLLHEYKNPGRRTQAIIKRTMKAFLLLAVISFCWAQYNPNTKP
GRTSIVHLFEWCWADIALECERYLAPNGFGGVQISPPNENIIITNPWRPWWERYQPISYN
LCTRSGYEHEFKDMVTRCNNVGVHVYVDAVINHMCGSGAGSGNSSTCGSYFNSGTRDFPA
VPYSAWDFNDGKCKTGSGGIENYHDVTQVRDCQLVSLLDLALEKDYVRSKIAEYMNNLID
IGVAGFRIDASKHMWPGDMTAILDKLKNLTEQWFAEGSRPFIYQEVIDLGEEPIKSSEYF
GNGRVTEFKYGAKLGTVLRKWNGEKMAYLKNWGEGWGFMPSDRALVFVDNHDTQRGHGAG
GASVLTFWDSRLYKMALGFMLAHPYGLTRVMSSYRWPRFFQNGKDINDWVGPPSYEDGSI
KPVTINPDTTCGNDWICEHRWRQIKNMVIFRNVVDDQPFTNWWDNDSNQVAFGRGNRGFI
IFNNDNWYLNVNLQTGLPNGTYCDVISGQKEDDHCTGLHVEVAGDGRANFQISNHAEDPF
IAIHVDATL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaatagttggccttttcaaatctgtaatttgtaccatgtactttaccctcttg
catgagtataaaaatccagggagaagaacacaagctattattaaaagaaccatgaaggcc
tttcttctgctagctgtcatttcattttgctgggcccagtacaacccaaatacaaaacct
gggaggacgtctattgtccacttatttgaatggtgttgggctgacattgctcttgaatgt
gaacggtatttagcacccaatggatttggtggagttcagatatctcctccaaatgaaaat
attataattactaacccatggaggccctggtgggaacgataccagccaatcagctacaat
ctatgtacacgatctggatatgagcatgaatttaaagacatggtgaccagatgcaacaat
gttggagttcatgtttatgtggatgctgtaattaatcacatgtgtggatctggtgctggc
tctggtaatagttctacttgtggaagctatttcaattcagggaccagagattttcctgct
gtgccatactcagcgtgggactttaatgatggtaaatgtaaaactggaagtggaggcatt
gaaaattaccatgatgtgactcaggtccgtgactgtcaacttgtcagtcttctcgatctc
gccctggagaaggactatgtgcgctcaaaaattgcggaatacatgaacaatcttattgat
atcggcgtggcaggcttcagaattgatgcttccaagcacatgtggcctggggacatgaca
gcaattttagacaaactgaaaaatctaactgaacagtggtttgccgaaggatcaagacct
ttcatttaccaggaggtaattgacttgggtgaagagccaatcaagagcagtgaatatttt
ggaaatggccgagtgactgaattcaaatacggtgccaaactgggtacagtactccgcaaa
tggaatggagaaaagatggcctatttaaagaactggggagaaggctggggtttcatgccc
tctgacagagctcttgtctttgtggataatcatgatacccagaggggacatggtgctggg
ggagcttctgttctaaccttctgggattccagattgtacaaaatggcacttggttttatg
cttgcacatccttatggattgacacgtgtaatgtcaagttatcgttggccaagatttttt
cagaatggaaaggacattaatgattgggtgggaccaccaagctatgaggatggatcaatt
aaacctgttacaattaatccggacactacttgtggcaacgactggatctgtgaacacaga
tggcgtcaaataaagaacatggttatcttccgtaatgtggttgatgaccagcctttcaca
aactggtgggacaatgacagcaaccaagtggcttttgggcgtggtaatagaggtttcatc
atctttaataatgacaactggtacttgaatgtaaacttgcaaactggtcttcccaatggc
acttactgtgatgttatttctggtcaaaaggaagacgaccactgtacaggattacacgtg
gaggtagctggtgatggcagggctaacttccagattagtaaccatgctgaggatcctttc
attgcaattcatgttgatgcaactttgtaa

DBGET integrated database retrieval system