KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102461096Help
Entry
102461096         CDS       T02980                                 

Gene name
PIK3CB
Definition
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:pss00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102461096 (PIK3CB)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    102461096 (PIK3CB)
   04370 VEGF signaling pathway
    102461096 (PIK3CB)
   04630 Jak-STAT signaling pathway
    102461096 (PIK3CB)
   04068 FoxO signaling pathway
    102461096 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    102461096 (PIK3CB)
   04150 mTOR signaling pathway
    102461096 (PIK3CB)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    102461096 (PIK3CB)
  Cell growth and death
   04210 Apoptosis
    102461096 (PIK3CB)
  Cellular commiunity
   04510 Focal adhesion
    102461096 (PIK3CB)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    102461096 (PIK3CB)
  Endocrine system
   04910 Insulin signaling pathway
    102461096 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    102461096 (PIK3CB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102461096 (PIK3CB)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102461096 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
ENSPSIG00000002460
UniProt: 
Position
Un
AA seq 1069 aa AA seqDB search
MPPAMADILDIWAVDSQIGADGLISVDFLLPTGTYINLDVPRDATISHIKQLLWKQAHSY
PLFHLLMEIDSYMFSCVNQTAVREELEDETRRLCDVRPFLPVLKLVTRNCDPGEKLDSKI
GVLIGKGLHEFDALQDPEVKEFRSKMRRISEEKLLSLVGLSWVDWLNHTYPPEQEPSIPE
NFQDKLYGGNLVVAVHFDKCQDVFSFQVSPNINPVKLNELAIRKRLTIHGKEDEVDPYDY
VLQISGRLEYIFGDHPLIQFQYIRNCVMNRTLPHLTLVECCSIKKMCDQEMIAIEAAINR
KSSNFPLPLPPKKTRTVTLLTQSVWDISYPFKIILFKGNKLNTEETAKVHVRAGLFHGTE
LLCKPIVSAEVFGRSEHIWSETLEFEINVCDLPRMARLCFAIYAIMDKMKTKKSTKTINP
PKYQTIRKAGKVHYPVAWVNTMVFDFKGQLKSGDLLLHSWTSFPDELEEMLNPMGTVQTN
PYTENATALHITFQEYSKFPIYYPPFDKILEKAAEIAKSSENVGMAGRGGKKFYIELKEI
MERDPLTQLCENEMDLIWTLRYDCRENFPQSLPKLLLSVKWNKLEDVAQLQALLQIWSKL
PPREALELLDFNYPDQYVREYAVGCLKQMSDEELSQYLLQLVQVLKYEPFLDCALSQFLL
ERALANRRIGQILFWHLRSEVHIPAVSVQFGVILEAYCRGSIAHMKVLSKQVEALNKLKT
LNSLIKLNSIKQSKTKGKDAMHTCLKQNAYREALSDLQSPLNPSVILSELYVEKCKYMDS
KMKPLWIVYNNKMFGGDLVGIIFKNGDDLRQDMLTLQILRLMDLLWKEAGLDLRMLPYGC
LATGDHSGLIEAVSSSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNLGDDLDRAIEEF
TLSCAGYCVATYVLGIGDRHSDNIMVRKNGQLFHIDFGHILGNFKSKFGIKRERVPFILT
YDFIHVIQQGKTGNTEKFGRFRQCCEEAYLILRRHGNLFITLFALMLTAGLPELTSVKDI
QYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctgcaatggcagacatccttgacatctgggcagtagattcacagataggagct
gatggcttaatctctgtggacttcctgcttcccactggaacctacatcaacctggatgtc
cctcgagatgccaccatatcccatattaaacagctactatggaagcaggcacacagctac
cctctatttcatcttcttatggagattgactcttacatgttctcatgtgtgaaccagacg
gctgtacgtgaggaattagaggatgaaacacgaaggctatgtgacgttagaccctttctt
cctgttctcaaactagtgacaaggaactgtgacccaggagaaaaattggattccaaaata
ggtgttcttataggaaaaggtctccatgagtttgatgctttacaggatcctgaagtgaaa
gaattccgtagtaaaatgcggcgaatcagtgaagagaaactcctgtcacttgtgggccta
tcttgggttgactggctaaaccatacttatccaccagaacaagaaccatcaatcccagaa
aactttcaagataaactctatggtggaaatcttgtagtggccgttcattttgataagtgc
caggatgtatttagttttcaagtgtctcctaacataaatcctgtcaaactgaatgaattg
gcaatccgaaaacgtttgactatccatggaaaggaagatgaagttgatccttatgactac
gtgttgcaaattagcggaagattggaatatatttttggtgaccatccattaattcagttc
cagtatatccgtaattgtgtgatgaacaggactctccctcacctgacactggttgagtgt
tgcagcataaagaaaatgtgtgaccaggaaatgattgccatagaagctgccataaaccga
aaatcatccaactttcctcttcctctgccaccaaaaaaaacacgaacagttactctgctg
actcagagtgtctgggatattagctatcctttcaagattatattatttaagggtaataaa
ttgaacacagaagaaactgccaaagttcatgtcagagctggtcttttccatggaactgag
cttctctgcaagccaattgtaagtgctgaagtatttgggagaagtgaacatatttggagt
gaaacactggaatttgaaatcaatgtctgtgacttgccaagaatggctaggctgtgcttt
gccatttatgctatcatggataaaatgaaaactaaaaagtcaaccaagacaattaatccc
cccaaataccagaccatcaggaaagctggaaaagtgcactatcctgtagcatgggtaaat
actatggtatttgactttaaaggacagttgaaaagtggagacctcttactgcacagttgg
acttcatttcctgatgaacttgaagaaatgttgaatccaatgggaacagtacaaactaat
ccttacactgaaaatgcaacggctttgcacattacatttcaagaatattcaaaatttcct
atttattaccctccctttgataagatacttgaaaaggcagctgagattgcaaaaagcagt
gagaatgttggtatggcaggtcgaggtggcaagaagttttatattgaactaaaagaaatt
atggaaagagaccccttgactcaactctgtgaaaatgaaatggatcttatttggactttg
cgatatgattgtcgtgagaatttcccacaatcactgccaaaacttctgctgtctgtaaaa
tggaacaaacttgaagatgttgctcagcttcaggctcttcttcaaatatggtcaaaactg
cctcctagagaagcattagaattactggatttcaattatccagaccagtatgtgagagaa
tatgcagtgggctgcttaaagcaaatgagtgatgaagaactctctcagtatcttctgcag
cttgtgcaagttctgaaatatgaaccttttcttgattgtgccctctctcagttcctgcta
gagagagcacttgctaataggagaatagggcagatacttttctggcatctaaggtcagag
gtgcacatacctgctgtctcagtacagtttggtgtaattcttgaagcttactgccgagga
agtattgctcacatgaaggttctttccaaacaggttgaagccctcaataaattgaagacc
ttaaatagtctaataaaactgaattccattaagcaaagcaaaacaaaaggaaaagatgca
atgcatacctgtttaaaacaaaatgcatacagagaagcactttctgatctccagtctcct
ttgaatccctctgttatactttcagaactatatgttgagaagtgtaaatatatggattct
aaaatgaaaccattatggatagtgtacaacaataagatgtttggaggggatcttgtaggg
atcatctttaaaaatggcgatgatctacgacaagacatgttgacactccagattttgcgt
ttgatggacttactttggaaggaagctggtctcgatctccggatgttgccatatggctgt
ttagcaacaggagaccattctgggcttattgaagctgtttcttcttcagaaacaattgca
gatattcagctaaatagtagtaatgtcgctgcagctgctgcgttcaacaaagatgctctc
ttaaattggctaaaggaatacaatttaggtgatgacctggatcgagcaattgaggaattt
actttgtcttgtgctggctactgtgtagctacttatgtattgggcattggtgacagacat
agtgacaatatcatggtcaggaagaatggtcagctctttcacatagattttgggcatatt
cttgggaacttcaaatccaaatttggaattaaaagggaacgagtgcctttcattcttacc
tatgacttcattcatgtcattcaacaaggcaaaacaggaaacactgaaaaatttggccgg
ttccgccagtgttgtgaagaagcatacttgattctgcgaagacatggaaatttatttatc
acactctttgcactgatgttaactgcagggcttccagagctaacctctgtcaaggatatc
cagtatctcaaggactctcttgccttagggaagagtgaggaagaagcactaaaacaattt
aagcaaaaatttgatgaagcactccgggaaagttggactacaaaagtgaactggatggct
cacactgttcgaaaagattacagatcctag

DBGET integrated database retrieval system