KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102462215Help
Entry
102462215         CDS       T02980                                 

Gene name
KAT8
Definition
K(lysine) acetyltransferase 8
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102462215 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 398 aa AA seqDB search
MGKLLENKPEDSAEVIQSRLNEQEAREEYYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNTDQYMNELSEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGHYEIDAWYFSPFPEDYGKQPKLWICEYCLKYMKFEKSYRYHLGQCQWRQPPGKEI
YRKNNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSICLKWAPPKHKQAKMSKK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggggaagctattggaaaataaaccagaggactcagccgaggtgattcagtcacgactc
aacgagcaggaggcccgggaggaatactatgtgcactatgtcggattcaaccggcgcctg
gatgaatgggtagataagaaccggctggccctcaccaagacagtcaaagatgcagtgcag
aagaacacagaccagtacatgaacgagctgtcagagcaacccgagcgtaagatcacccgc
aaccagaagcgcaaacatgacgagatcaaccatgttcagaagacctacgcagagatggat
cccaccacagctgccctggagaaggagcatgaggcgatcaccaaggtgaaatacgtagat
aagatccacattggccactatgagatcgatgcctggtatttctcccccttcccggaggat
tatgggaagcagcccaagctgtggatctgcgagtactgtctgaaatacatgaagttcgag
aagagctacaggtaccacctaggccaatgccagtggagacagccaccagggaaggagatc
tacaggaagaacaacatctcggtctatgaagtggatggcaaagatcacaagatttactgc
cagaacctgtgtcttctggccaagctcttcctagaccacaagactctctacttcgacgtg
gagcccttcgtcttctacatcctcaccgaggtcgacaggcagggagcccacatcgtcggc
tacttctccaaggagaaggagtctccggatgggaacaacgtggcctgtatcctcaccctg
cccccctaccagagacggggctatggcaagtttctcatcgcgttcagctatgagctgtct
aagctggaaagcacggtgggctccccagagaagcccctctcggacctgggcaagctgagc
taccggagctactggtcctgggtgctgctggagatcctgagggacttccgagggaccctg
tccattaaagacctcagccagatgaccagcatcactcagaacgacatcatcagcacgctg
cagtccctcaacatggtgaaatactggaaggggcagcacgtcatctgcgtcacgcccaag
ctggtggaggaacatctgaagagcgcccagtacaagaagcctcccatcacagtggattcc
atctgtctcaagtgggcgccccccaagcacaagcaggccaagatgtccaagaagtga

DBGET integrated database retrieval system