KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102463058Help
Entry
102463058         CDS       T02980                                 

Gene name
PCSK2
Definition
proprotein convertase subtilisin/kexin type 2
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     102463058 (PCSK2)
Peptidases [BR:pss01002]
 Serine Peptidases
  Family S8: subtilisin family
   102463058 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 644 aa AA seqDB search
MEIHIVEEDSLSCYTPFMDNSLFPLGFDIRAETGPGLLFLLSLLGAMHCQAHMYWSSRSF
SDFSQLPFVDDGYHFYHNGISRARRRRSLQHKLHLEKDPRIKKAVQQEGFGRKKRGYREI
NEIDINMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLH
PDLASNYNAKASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSK
VAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDNGKTVDGPRELTLQAMADGVN
KGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLAST
FSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTV
LTSKRNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSIQ
EPEKIPSSGKLVLSLTTDACEGKENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSI
LLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWILEIGFVGSVPQKGVLKEWTLMLHGT
QSAPYIDQIVRDYQSKLAMSKKEELEEELDEAVERSLKSILSKN
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggaaatccacatagtggaggaagactccctctcctgttacaccccttttatggataat
agtttattccccttgggctttgatatccgtgcagagacaggtccaggacttctcttcctc
ctgagccttctgggagctatgcactgccaagctcatatgtactggagcagtaggagcttc
agtgacttcagtcaacttccctttgtagatgatgggtaccacttttatcataatggcatc
tctagggccaggagaagacgcagtcttcagcacaagcttcatttggaaaaagacccgagg
ataaagaaggctgtgcagcaggaaggctttggcagaaaaaagcgaggctaccgagagatc
aatgaaattgacataaacatgaatgatcctttatttacaaagcagtggtacctgatcaat
actggtcaagcagatgggacccctggacttgatctaaatgtggctgaagcctgggagctg
ggatacacagggaaaggagttactataggaattatggatgatggaattgattatcttcat
cctgatcttgcctcaaattataatgccaaagccagctacgacttcagcagtaacgatccc
tacccatatccccgctacacagatgactggtttaacagtcatggaaccaggtgtgcaggg
gaagtgtcagctgcagcaaacaataacatctgtggagttggcgtggcatacaactcgaag
gtggcaggtatccgaatgctggaccagccttttatgaccgacattatcgaagcttcctct
atcagtcacatgcctcaagtcatagatatatatagcgccagctgggggccaacagataac
ggaaagactgtggatggacctagagagttgactttgcaagccatggcagatggggtgaac
aagggccgtggcggcaagggaagcatctacgtctgggcctctggagatggaggcagctac
gatgattgtaactgtgatggctatgcatcaagcatgtggactatctccatcaattctgcc
attaatgatggccggactgctctgtatgatgaaagctgctcttcgaccttggcttccact
ttcagcaatgggaggaagagaaatcctgaggctggtgtggcaacgacagatttgtatggc
aactgtaccctccgtcattctggcacatctgcagctgcaccggaggcagctggagtgttt
gcattggcactagaggctaacctggatctgacatggagagacatgcagcatctgacggta
ctcacctccaaaaggaatcagctgcatgacgaagtccatcaatggcgtagaaatggggtt
ggtctggaatttaaccatttgtttggctatggcgtcctcgatgcaggagcaatggttaaa
atggcgaaagactggaagactgttccagagagattccactgtgttggaggatcaatacaa
gaacctgaaaaaataccatcaagtggcaagcttgttctgtcactcacaaccgatgcttgt
gaggggaaagaaaattttgtccgctacctggaacatgtgcaagcagttataacagtgaac
tctactaggcgaggggacctcaacatcaacatgacatcaccgatggggactaaatccatt
ttactgagccggcggccaagagatgatgactccaaggtgggttttgacaaatggcctttc
atgacaacacacacttggggagaagaccctagaggcacttggattctggaaattgggttt
gttgggagcgtgccacagaaaggagtactgaaggaatggacactgatgctacatgggaca
caaagcgcaccctatatagaccaaatagtaagagattaccagtccaaactggctatgtcc
aagaaggaagagcttgaagaagaattagatgaagcagtagagagaagcctgaagagtata
ctgagcaagaactag

DBGET integrated database retrieval system