KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102463153Help
Entry
102463153         CDS       T02980                                 

Definition
lysozyme C-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102463153
Exosome [BR:pss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102463153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
ENSPSIG00000016201
UniProt: 
Position
Un
AA seq 148 aa AA seqDB search
MKALLILGLFLLPLAAHGKIYERCELARAMKRLGLDGYWGYSLGNWVCTARFESQFNTSA
TNYNRGDQSTDYGILQINSHWWCNDGKTPGAKNACGIQCSDLLTADITNSVNCAKRVVRD
PNGMAAWVAWTRNCKGRDVSQWIRGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttgctaatcttggggcttttcctcctgcctctggctgctcatgggaagatc
tacgagaggtgtgagctggcaagagcaatgaaacgtcttgggctggatggatactggggc
tacagcctgggaaactgggtgtgcacagcaagattcgagagccagtttaacacgagcgcc
acgaactataaccgaggtgaccaaagcaccgactatgggattttacaaatcaacagccac
tggtggtgcaatgatggcaagaccccaggagccaagaacgcatgtggcatccagtgtagc
gatttactgacagctgacattacaaatagtgtaaactgtgcaaagagagttgttcgcgat
ccaaatggcatggctgcatgggtggcatggacaaggaactgcaaaggacgagatgtctcc
caatggatcaggggctgtggggtctaa

DBGET integrated database retrieval system