KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102463338Help
Entry
102463338         CDS       T02980                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102463338 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1470 aa AA seqDB search
MAALMRDFEKTSSESYTEYKAGCRVSLASPLPSIPLSSWPYSDERDNGTDVEEQTVAGVH
SVGCFSIKMSGLGENSLDSLTNESRKRKPLPCDAQGPGLTCSGEKRRREQESKYIEELAE
LISANLSDIDNFNVKPDKCAILKETVRQIRQIKEQGKTSSSDDDVQKADVSSTGQGVIDK
DSLGPLLLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYSILHEEDRKDFL
KNLPKSAVNGVAWTNETPRQKSHTFNCRMLVKASHDLLDDLGSSQDSRQRYETMQCFALS
QPRAMMEEGEDLQSCMICVARRISTVERVFSTNPESFITRHDLSGKLVNIDTNSLRSSMR
PGFEDTIRRCIQRFLCHNDGQSWSNKRHYQEAYIQGHAETPLYRFSLADGTIVTAQTKSK
LFRNPVTNDRHGFVSTHFLQREQNGYRPNPNPVAQNIRAPTAGNTNSVGAITNMSPSQSM
SMQNRNYGMGDPSVMGQMSGIRYVGPGNIGPISSGPGMQSSPYQNNSYGLTMNSPPHGSP
SLTSSQQNLMISPRNRGSPKMGSHQFSPVAGMHSPMGSASNTSNNSFSSSSLSALQAISE
GVGTSLLSTLSSPGPKLDNSPNMNIAQQTKMVNQESKSPSGLYCEQSQVESSMCQSNNRD
LLSDKDSKEGHLEGSESQRGPNESKGHKKLLQLLTCSSDERGHSTLSNSPLDSGCKESST
NVTSPSGVSSSTSGGVSSSSNVHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTY
HDSSSTATCVEGTIKQEQLSPKKKENNALLRYLLDKDDVKEMKPKVEGLDNKMGQCSSSS
IPTSSQEKEIKIKTEPSEEMSGDLDNLDAILGDLTSSDFYHNSVSTNGSNLGTKHTLFQG
NAPLGMRSPQSVQTARPPFNRAMSLDSPIPVGSSPPVRSNAFSMLQKQNMMGGSPRMIEN
HENFGAHMGGPNRNMAMNQHLAGDWVLPNSKVNRLEPTSSNSLVRPGPDYNPSLPRPAVS
GSMPGLPIRSNSIPGTKPVLQQQMINMRPNEINMAMGSNPYGQPGPSSQPGSWPDGMLSM
EQGPRVSQTRQLLRSSLDDFLCPLPNIEGQSDERALLDQLHTLLSNTDVTGLEEIDRALG
IPDLVNQGQTLEPKQDSFQGQESSVMIDQKPPLYGQPYQGQGAAMPGGFTNMQGQQQSFN
SMMNQMSQQSGFPLQSMHPRASVMRPRTNTPKQLRMQLQQRLQGQQFLNQTRQALEMKME
NPGTGGAPGLRPVMQPQVGSQQGFLNAQMVAQRNRELISHHIRQQRMAMMIQQQQQQQQQ
QQPQAFSPPPNVTASGSMDSSLAGPPMAQVPSQQFPYPPNYGISQQPDPTFSRVASPPNP
MMSSRIGPSQNPMMQHSQAAAMYQSPEMKGWSSGNMARSSSFPQQQFSHQGSPTTYNMMH
MNGSSGHIGQMNINTMPMSGMSMGPDQKYC
NT seq 4413 nt NT seq  +upstreamnt  +downstreamnt
atggcggcactcatgagagattttgagaagacaagttcagaaagctacactgagtacaaa
gcaggctgccgtgtctcactagcatctcctcttccctccatccccctcagcagttggcct
tacagtgatgagagggacaatggaacagatgtggaagaacagacagttgccggtgtacac
tcagttggctgtttctcaatcaagatgagtggattaggagaaaattccttggacagcttg
accaatgaatcaaggaaacgcaagccattgccctgtgatgcccaaggacccggtctcaca
tgcagtggtgagaaacgccgacgtgagcaggaaagcaaatatattgaggaactagctgag
ttgatatctgctaatctgagtgacattgacaatttcaatgtcaaaccagataaatgtgca
attttaaaggaaactgtaagacagatccggcagataaaggaacaaggaaaaacatcatcc
agtgatgatgatgtacagaaggctgatgtatcttctacaggtcaaggggttattgataag
gattcattgggacctcttttactacaggcattggatggtttcctgtttgtagtaaatcga
gatgggaacattgtgtttgtatcagaaaatgtcacacagtatctgcaatataaacaagaa
gatttggttaatacaagcgtctacagtatcttgcatgaagaggaccgaaaagacttcctt
aaaaatttacccaaatctgcagttaatggagttgcttggaccaatgaaacacctagacag
aagagccatacatttaattgccgtatgttggtaaaagcatctcatgatcttttggatgat
ttgggcagcagccaggattcacgtcagagatacgaaaccatgcagtgttttgctttatct
cagccccgagctatgatggaagaaggagaagatttgcagtcttgtatgatttgtgtggca
cgtcgcatttctacagtggaaagggtattttcaaccaacccagaaagttttattacgaga
catgacctttcaggtaaactcgtcaatatagatacaaactcattacggtcttccatgaga
cctggctttgaagatacaatccgtcggtgtattcagaggtttttatgccataatgatgga
cagtcctggtcaaacaaacgccactatcaagaagcttatatacaaggccatgctgaaact
ccactatatcggttctccttagcagatggcactatagtaacagcacaaacaaagagtaaa
ctgttccgaaatccagtaactaatgatcgtcatggatttgtctccacccactttcttcaa
agagaacagaatggatatcgaccaaatcccaatccagtggcacaaaacatcagagcacct
acagctggaaacacaaattctgttggtgctattacgaatatgtcaccaagtcaaagcatg
tcaatgcagaacagaaactatggcatgggagatcccagcgtgatgggacagatgagtggc
attagatatgtaggacctggtaatattggaccgatcagctctggaccaggaatgcagtcc
tctccttatcagaacaacagttatggattaactatgaatagtccaccacatggtagtcca
agcttgacctccagccaacagaacttaatgatttctcctaggaatcgtgggagtccaaaa
atgggttcgcaccagttttctccagttgcaggtatgcactccccaatgggatctgctagc
aacactagcaacaacagcttctctagcagttctcttagtgcccttcaagccattagtgag
ggtgttggaacttcccttctatcaacgctttcctcaccgggtccaaagttggataattcc
ccaaatatgaatatagctcagcaaactaaaatggtcaaccaggaatcaaagagcccttct
ggcttgtattgtgaacaaagtcaagtggagagttccatgtgccagtcaaataacagggac
ctccttagtgacaaagacagtaaagaaggacacttggaagggtctgagagtcagagggga
ccaaatgaaagcaaaggacataaaaagctccttcagttactcacatgctcctcagatgag
agagggcattctacgttgtcaaactcaccattggactctgggtgcaaagaatcttctacc
aatgttactagtccctcaggagtctcctcttctacatctggaggggtctcttcctcatca
aatgtgcatgggtccctgctacaagaaaaacacaggattttgcataaattgttgcagaat
ggtaattctccagcagaagtagcgaagatcacagctgaagctactggtaaagatacctac
catgactccagcagtacagccacctgtgtagaaggaactatcaaacaggaacaactgagt
cctaagaagaaggaaaacaatgctttactcagatacctactagacaaggatgatgtaaaa
gaaatgaaacctaaggtagaaggactggataataaaatgggacaatgcagtagctcctct
attcctacttcaagtcaagaaaaggaaatcaaaataaaaacagaaccttctgaagagatg
agtggagacttggataatttggatgcaatactgggtgatctgactagttctgatttttac
cataattctgtatctacaaatgggagtaaccttggaactaagcacacattatttcaagga
aatgcccccttgggtatgagaagtccccaatctgtgcagactgcccgtcctcctttcaac
agagccatgtctttagacagccctatacctgtgggttcaagccctccagtgaggagtaat
gcattctccatgttacaaaagcaaaacatgatgggtgggagtccaagaatgattgagaac
catgaaaattttggagcacatatgggtggacccaacagaaatatggctatgaatcagcat
ctggcaggagactgggttttgccaaactccaaggttaacagactggaacctacaagttct
aattcattggtgagaccaggaccagactataatccatcccttcccagacctgcagtgagt
ggctccatgcccggattgcccatccggtctaatagcatacctggtacaaaaccagtgcta
caacagcagatgattaatatgagacctaatgagattaatatggctatgggaagtaaccct
tatgggcaaccaggaccatctagccagccaggatcatggcctgatggtatgctttccatg
gagcaaggacctcgagtgtcacaaaccagacaattacttagaagttctttggatgacttc
ttatgtccacttcctaacatagaaggccagagtgatgaaagagctcttttagatcagttg
cacacattgctgagtaacacagatgtcacaggacttgaggaaattgacagagcattagga
attcctgatcttgtaaatcaaggtcaaactttggaaccgaagcaagattcatttcaaggt
caggaatcttcagttatgattgaccagaagcctccattatatggtcaaccctatcagggg
caaggggcagcaatgccaggaggttttactaacatgcagggacaacagcaatcttttaat
tcaatgatgaatcagatgagccaacagagtggttttccactgcaaagtatgcatcctaga
gcaagtgtgatgagaccccgaaccaatacaccaaagcagctcagaatgcaactccagcag
aggcttcaggggcagcagtttctcaatcagacccgtcaagcacttgagatgaaaatggaa
aacccgggtactggtggtgccccaggcttgaggccagttatgcagccacaagtggggtca
cagcaaggttttcttaatgctcagatggtggctcaacgcaacagggagctaataagtcat
catatcagacagcagaggatggcaatgatgatacagcagcagcagcagcagcagcaacaa
cagcaacctcaggccttcagtccaccaccaaatgtgactgcctcaggaagcatggacagt
tctctggcaggtcccccaatggctcaagttccttcacagcaattcccatatccgcctaat
tatggaataagccaacaacctgatcccaccttcagtagagtagcaagccctccaaaccca
atgatgtcatcaagaattggaccctcccaaaatcccatgatgcagcattctcaggcagca
gcaatgtatcagtcccctgagatgaaaggctggtcatcaggaaacatggccaggagcagt
tcttttccacagcagcaattcagccatcaaggcagccctacaacttataatatgatgcat
atgaatggcagcagtggtcatattggacaaatgaatattaacaccatgcccatgtccggc
atgtctatgggtccagaccagaaatactgctga

DBGET integrated database retrieval system