KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0002Help
Entry
PSPTO_0002        CDS       T00118                                 

Gene name
dnaN
Definition
(RefSeq) DNA polymerase III subunit beta
  KO
K02338  
DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PSPTO_0002 (dnaN)
   00240 Pyrimidine metabolism
    PSPTO_0002 (dnaN)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PSPTO_0002 (dnaN)
   03430 Mismatch repair
    PSPTO_0002 (dnaN)
   03440 Homologous recombination
    PSPTO_0002 (dnaN)
Enzymes [BR:pst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PSPTO_0002 (dnaN)
DNA replication proteins [BR:pst03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PSPTO_0002 (dnaN)
DNA repair and recombination proteins [BR:pst03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     PSPTO_0002 (dnaN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1913..3016
Genome map
AA seq 367 aa AA seqDB search
MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLTGTDLEVELVGRVQLE
EPAEPGEITVPARKLMDICKSLPNDALIDIKLDDSKLIVKAGRSRFTLSTLPANDFPTVE
EGPGSLTFNLVQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVSAGILRAVATDGHRLAMC
SMSADIEHADRHQVIVPRKGILEMARLLTEQDGMVSIVLGQHHIRATTGEFTFTSKLVDG
KFPDYERVLPKGGDKLVLGDRQSLREAFSRTAILSNEKYRGIRLQLANGQLKIQANNPEQ
EEAEEEIGVEYNGEALEIGFNVSYLLDVLSVMTTEQVRLILSDSNSSALVQESDNDDSAY
VVMPMRL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcaccattcaacgcgaagccctgttgaaacccctgcaattggtcgccggcgtg
gtagaacgccgccagaccttgccggttctttccaatgtgcttctggtcgtgcaaggccag
cagctgtcgctgaccggtactgacctggaagtcgagctggttggccgtgttcagctggaa
gagcctgccgaacctggggaaatcaccgttcccgcgcgcaagcttatggacatttgcaaa
agcctgcccaatgatgcgctgatcgacatcaagcttgatgactcgaaactgatcgtgaag
gcaggtcgcagccggttcacgttgtccacgctgcctgccaacgatttcccgacggtggaa
gaaggccccggctcgctgacgttcaatctggtgcaaagcaaactgcgtcgcctgatcgag
cgcaccagctttgcgatggctcagcaggatgttcgctattaccttaacggcatgctgctt
gaagtcagtgccggaatcttgcgtgcagtggctaccgatggccaccgtctggcaatgtgc
tcgatgtcagccgatatcgaacacgccgaccgtcatcaggtcatcgtgcctcgtaaaggt
attctggagatggcgcgtttgctgaccgagcaggacggcatggtcagcatcgtgctgggt
cagcatcacatccgcgccaccaccggtgaatttacctttacctcgaaactggtcgatggc
aagttcccggattacgagcgtgtgttgcccaagggtggcgacaagctggtactgggcgat
cgtcagtccctgcgtgaagcgttcagccgcaccgcgattctgtccaacgagaagtaccgt
ggcattcgtctgcaactggctaacggccaactgaaaattcaggccaacaatcctgagcag
gaagaggcagaagaagaaatcggcgtcgagtacaacggtgaggcgttggagatcggtttc
aacgtgagctacttgctcgacgtgctgagcgtcatgaccaccgaacaggttcgcctgatt
ctctctgactccaacagcagcgctctggtgcaagagtcggataacgacgattccgcctac
gttgtcatgccgatgcgtctgtaa

DBGET integrated database retrieval system