KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0083Help
Entry
PSPTO_0083        CDS       T00118                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPTO_0083 (algC)
   00030 Pentose phosphate pathway
    PSPTO_0083 (algC)
   00051 Fructose and mannose metabolism
    PSPTO_0083 (algC)
   00052 Galactose metabolism
    PSPTO_0083 (algC)
   00500 Starch and sucrose metabolism
    PSPTO_0083 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PSPTO_0083 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PSPTO_0083 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSPTO_0083 (algC)
Enzymes [BR:pst01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PSPTO_0083 (algC)
    5.4.2.8  phosphomannomutase
     PSPTO_0083 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(103735..105132)
Genome map
AA seq 465 aa AA seqDB search
MNSPASVAPILPDTIFRAYDIRGVVEDTLNAETAYWIGRAIGSESLAQNEPNVSVGRDGR
LSGPELVQQLIQGLHDSGCHVSDVGLVPTPALYYAANVLAGKTGVMLTGSHNPKDYNGFK
IVIAGDTLANEQIQALHERIKTNNLTSQKGSITQVNILDRYFKQIKDDIVMARKLKVVVD
CGNGAAGVIAPQLIEALGCEVISLFAEVDGNFPNHHPDPGKLENLQDLIAKVKETGADLG
LAFDGDGDRVGVVTNAGNVVYPDRLLMLFALDVLKRNPGADIIFDVKCTRRLTPLISEHG
GRPVMWKTGHSLIKKEMKKSGALLAGEMSGHIFFKERWFGFDDGIYSAARLLEILSQEPA
NAEDLFETFPNDISTPEINIKVTDVTKFSIIEALEKDAQWGDAKLTTIDGVRVDYPKGWG
LVRASNTTPVLVLRFEAETQAELERIQGVFHAELKKVAPDLDLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcccagcatccgtggcacccattctccccgacactattttccgtgcgtatgac
atccgcggcgtggtcgaagataccctcaacgctgaaacggcgtactggatcggtcgcgca
atcggctccgaaagcctggcgcagaacgaacccaatgtcagcgttggccgcgatggtcgt
ctttccggtcctgagctggtgcagcaactgatccagggcctgcacgacagcggttgccat
gtcagcgacgtcggtctggtgccgacgcctgcgctgtattacgcagccaacgtgctggcc
ggcaagaccggcgtcatgttgaccggtagccacaaccccaaggactacaacggcttcaag
atcgtcatcgcgggcgataccctcgccaacgagcagatccaggcgctgcacgagcgcatc
aagaccaacaacctgacctcgcaaaaaggcagcatcacccaagtcaacatcctcgatcgc
tacttcaagcagatcaaggacgacattgtcatggcgcgcaagctcaaggtcgtggtcgat
tgcggcaatggtgcggcaggtgtgatcgccccgcagttgatcgaagcgctgggctgcgaa
gtgatttccctgttcgccgaggtggacggcaacttcccgaaccatcacccggacccgggc
aagctggaaaacctgcaagacctgatcgccaaggtcaaggaaaccggtgccgatctgggt
ctggccttcgacggtgacggcgaccgtgtcggtgttgtgaccaacgcaggcaatgtggtt
tatcccgaccgcctgttgatgctgttcgcgctggatgtactcaagcgcaatccgggtgcc
gacatcattttcgacgtcaaatgcacacgtcgcctgacgccgctgatcagcgaacacggt
ggtcgtccggtcatgtggaaaaccggtcactcgctgatcaagaaagaaatgaaaaaaagc
ggcgcgttgctggctggcgaaatgagcggccatatcttcttcaaggagcgctggttcggt
ttcgatgacggcatctacagcgcggcacgtctgctggagatcctcagccaggaaccggcc
aatgccgaagacctgttcgagaccttcccgaacgacatttcgacgcctgaaatcaacatc
aaggtgacggacgtcaccaagttcagcatcattgaggcccttgagaaagacgcccaatgg
ggcgacgccaaactgaccactatcgacggtgtccgtgtggactatccgaagggctggggt
ctggttcgcgcttccaacaccacgccggtgctggtgctgcgttttgaggctgaaacccag
gccgaactggagcgtatccagggtgtgttccacgctgagctcaagaaagttgcgccggac
ctcgacctgccattttga

DBGET integrated database retrieval system