KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0129Help
Entry
PSPTO_0129        CDS       T00118                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSPTO_0129 (hemD)
Enzymes [BR:pst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PSPTO_0129 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
153498..154274
Genome map
AA seq 258 aa AA seqDB search
MSAWRLLLTRPAEESAALARVLADAGIFSSSLPLLETEPLPLTPAQRSIIFELLNYSAVI
VVSKPAARLAIELIDEVWPQPPMQPWFSVGSATGQILLDYGLDASWPEQGDDSEALLDHP
RLKQAIAVPGSRVLIMRGNEGRELLAEQLRERGVGVDYLPLYRRYLPQHAPGTLLQRVEV
ERLNGLVVSSGQGFEHLLQLAGDSWPDLAGLPLFVPSPRVASLAQAAGARNVIDCRGASA
AALLAALRDQPQPAVKAY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctggcgtctgctgctgacccgtcccgccgaagaatcggcggcgctggcaagg
gtgctggcagatgccggaatcttcagcagcagtctgcctttacttgaaaccgagccttta
cccttgacgcctgcacagcgttcgatcattttcgagctgctcaattacagtgcagtcatc
gtggtcagcaaacctgctgcgcggctggccatcgaactgatcgatgaagtgtggccgcaa
ccgcctatgcagccgtggttcagtgtgggttcagcaaccgggcagatactccttgattac
ggactcgatgcgagctggccggagcagggcgatgacagcgaggccttgctcgaccatcca
cgccttaaacaggcgattgccgtacctggaagtcgcgtactgatcatgcgcggcaatgag
ggacgtgaactgctggccgagcaattacgcgaacggggggtgggtgtcgattacctgccg
ctgtaccgtcgctacctgccgcagcacgcccccggcaccctgttgcaacgcgtagaggtg
gaacgcttgaacgggctggtggtcagcagtgggcagggttttgaacatttgcttcagttg
gcaggtgattcatggccggatctggccggtctgccgctgtttgtaccgagcccccgggtt
gccagccttgcgcaggcagcgggcgcccggaacgttattgattgtcgtggcgccagcgca
gcggcattgctggcagcgttgcgggatcaaccccagcctgccgtcaaagcgtattga

DBGET integrated database retrieval system