KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0158Help
Entry
PSPTO_0158        CDS       T00118                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00260  Glycine, serine and threonine metabolism
pst00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01130  Biosynthesis of antibiotics
pst01230  Biosynthesis of amino acids
Module
pst_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSPTO_0158 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSPTO_0158 (trpB)
Enzymes [BR:pst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSPTO_0158 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 1181766
NCBI-ProteinID: NP_790017
UniProt: Q88B61
Position
178848..180077
Genome map
AA seq 409 aa AA seqDB search
MTQTNFRSGPDANGLFGSFGGRYVAETLMPLVLDLNREYEAAKADPEFIKEMAYFQRDYI
GRPNPLYFAERLTEFCGGAKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTSGTGTLKDAMNE
ALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQSVIGKETKEQMQEKEGRLPDSLIACVG
GGSNAMGLFHPFLDDASVEIIGVEAGGHGVDTDKHAASLNGGVPGVLHGNRTYLLQDNDG
QITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDEEALDAFHQCCLLEGIIPALETA
HALAEAMKRATNLRDDHLMVVCLSGRGDKDMQTVMNHMAAADNTQEKLV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccaactttcgcagcggccccgacgccaacggcctgttcggctcattcggc
ggtcgctacgtagctgaaaccctgatgccgctggtgctggacctcaaccgcgagtacgaa
gccgccaaggccgatcctgagttcatcaaggaaatggcctacttccagcgcgattacatt
ggccgtcccaatccgctgtacttcgccgagcgcctgaccgaattctgtggcggcgcgaaa
atctacttcaagcgtgaagagctcaaccacaccggcgcgcacaagatcaacaactgcatc
ggccaggtgctgctggccaagcgcatgggcaaaaaacgcctgatcgctgaaaccggtgca
ggcatgcacggcgttgccactgcaaccgttgccgcgcgtttcggcctgccttgcgtaatc
tacatgggcgcgaccgacatcgagcgtcaacaggccaacgtgttccgcatgaagctgctg
ggcgctgaaatcgtgccggtcacttccggcaccggcaccctgaaagacgcgatgaacgaa
gccctgcgcgactgggtaaccaacgtcgatgacacgttctacctgatcggcacggtggca
ggcccgcacccgtatccggcgatggtgcgcgacttccagtccgtcatcggcaaggaaacc
aaagagcaaatgcaggagaaggaaggccgtctgccggacagcctgatcgcctgcgtcggt
ggtggctccaacgcgatggggctgttccatccgttccttgatgacgccagcgtagaaatc
atcggcgtcgaagcgggcggtcatggcgtggacaccgacaagcatgcagccagcctgaat
ggcggcgtaccgggcgtgctgcacggcaaccgcacctacctgttgcaagataacgacggg
caaatcaccgacgctcattcgatttctgctggcctggactaccctggcatcggcccggaa
cacgcttacctgcacgaagtgaagcgcgtcgaatacgtcagcatcaccgacgaagaagcg
ctcgacgcgtttcatcagtgctgcttgctcgaaggcattatcccggcgctggaaaccgct
cacgcactggccgaagccatgaagcgcgcgaccaacctgcgcgacgatcatttgatggtc
gtgtgcctgtccgggcgcggcgacaaagacatgcaaaccgtcatgaaccacatggcagcc
gccgacaacactcaggagaagctggtatga

DBGET integrated database retrieval system