KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0158Help
Entry
PSPTO_0158        CDS       T00118                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSPTO_0158 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSPTO_0158 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSPTO_0158 (trpB)
Enzymes [BR:pst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSPTO_0158 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
178848..180077
Genome map
AA seq 409 aa AA seqDB search
MTQTNFRSGPDANGLFGSFGGRYVAETLMPLVLDLNREYEAAKADPEFIKEMAYFQRDYI
GRPNPLYFAERLTEFCGGAKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTSGTGTLKDAMNE
ALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQSVIGKETKEQMQEKEGRLPDSLIACVG
GGSNAMGLFHPFLDDASVEIIGVEAGGHGVDTDKHAASLNGGVPGVLHGNRTYLLQDNDG
QITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDEEALDAFHQCCLLEGIIPALETA
HALAEAMKRATNLRDDHLMVVCLSGRGDKDMQTVMNHMAAADNTQEKLV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccaactttcgcagcggccccgacgccaacggcctgttcggctcattcggc
ggtcgctacgtagctgaaaccctgatgccgctggtgctggacctcaaccgcgagtacgaa
gccgccaaggccgatcctgagttcatcaaggaaatggcctacttccagcgcgattacatt
ggccgtcccaatccgctgtacttcgccgagcgcctgaccgaattctgtggcggcgcgaaa
atctacttcaagcgtgaagagctcaaccacaccggcgcgcacaagatcaacaactgcatc
ggccaggtgctgctggccaagcgcatgggcaaaaaacgcctgatcgctgaaaccggtgca
ggcatgcacggcgttgccactgcaaccgttgccgcgcgtttcggcctgccttgcgtaatc
tacatgggcgcgaccgacatcgagcgtcaacaggccaacgtgttccgcatgaagctgctg
ggcgctgaaatcgtgccggtcacttccggcaccggcaccctgaaagacgcgatgaacgaa
gccctgcgcgactgggtaaccaacgtcgatgacacgttctacctgatcggcacggtggca
ggcccgcacccgtatccggcgatggtgcgcgacttccagtccgtcatcggcaaggaaacc
aaagagcaaatgcaggagaaggaaggccgtctgccggacagcctgatcgcctgcgtcggt
ggtggctccaacgcgatggggctgttccatccgttccttgatgacgccagcgtagaaatc
atcggcgtcgaagcgggcggtcatggcgtggacaccgacaagcatgcagccagcctgaat
ggcggcgtaccgggcgtgctgcacggcaaccgcacctacctgttgcaagataacgacggg
caaatcaccgacgctcattcgatttctgctggcctggactaccctggcatcggcccggaa
cacgcttacctgcacgaagtgaagcgcgtcgaatacgtcagcatcaccgacgaagaagcg
ctcgacgcgtttcatcagtgctgcttgctcgaaggcattatcccggcgctggaaaccgct
cacgcactggccgaagccatgaagcgcgcgaccaacctgcgcgacgatcatttgatggtc
gtgtgcctgtccgggcgcggcgacaaagacatgcaaaccgtcatgaaccacatggcagcc
gccgacaacactcaggagaagctggtatga

  All links  
No link information was found.   
DBGET integrated database retrieval system