KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0159Help
Entry
PSPTO_0159        CDS       T00118                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSPTO_0159 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSPTO_0159 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSPTO_0159 (trpA)
Enzymes [BR:pst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSPTO_0159 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
180074..180886
Genome map
AA seq 270 aa AA seqDB search
MSRLEQRFAQLKTEGRAVLVTFITAGDPGYDTSLKVLKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALDAGQTLLKTLQMVSEFRVDDQTTPIVLMGYYNPIHRFGVEAFVAQAKE
AGVDGLIIVDLPPEHDAELATPAQASGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTSLPISVGFGIRTPEQAAAIARLADGVVVGSAFVDKI
ATAESPEQAIDGVLTLCAALAEGVRNARVS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtctcgaacaacgtttcgcccagctgaaaaccgaaggtcgcgcggtactggtc
accttcatcaccgctggcgaccctggctacgacacctcgctgaaagtgctcaaaggcctg
cccgctgcaggtgctgacgtgatcgagctgggcatgccgtttaccgatccgatggctgat
ggtgtggccattcagctggccacgttgcgcgccctggacgccggccagacgttgctgaaa
accttgcagatggtcagcgagtttcgtgtcgacgatcagaccacgccgattgtgctgatg
ggttattacaacccgatccaccgttttggcgtcgaagcgttcgtggcacaggccaaggaa
gcgggcgtcgatggcttgatcatcgttgacctgccgcccgagcatgacgccgaactggcg
acgcctgcacaggcgtccggcatcgacttcatccgcctgaccacgccgactaccgacgat
gcgcgtctgccgcgcgtactggagcgcagttccggtttcgtctactacgtgtcggtcgcc
ggtgtgaccggtgcgggttcagcgaccaccgagcacgtcaccgaagccatcgcacgcctg
cgtcgccacaccagcctgccgatcagcgtcggtttcggtatccgcacacctgagcaggca
gcggccattgcgcgtctggctgacggtgttgtggtgggctcggcgttcgtcgacaagatc
gccacagccgagtcgccggagcaggcaatcgatggcgtgttgacgctgtgcgccgcactg
gccgaaggcgtacgtaacgcccgcgtcagttga

DBGET integrated database retrieval system