KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0339Help
Entry
PSPTO_0339        CDS       T00118                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pst  Pseudomonas syringae pv. tomato DC3000
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(368509..370542)
Genome map
AA seq 677 aa AA seqDB search
MSDEAERWREKYLKGIEQQDKLEKRWDARLDLLRRGLVRSSLAAEGSDRAVDECMKEMRE
IVRRDDMDAGLAALIPRLEKAVLDSEQRREVRVGQIGSALTALVTQLQALPLTREVRKPL
KRFAKDLEERAAQARELPLLLSELSGLQGQALTQLEKQDEGQRPGLLQRLFGSRDEHGNE
HPPEAAHPQSLPPAQEMHDEVHEPPEAPDAQAPTSPAPAALEREIESKPAVPAPEPNAET
PALTNTVEPVPPPAAVSVAPVPVEITVEPASVPVEHIDTTDMLAPTPIVPYQQRPAPAAL
EVEPEDDPEPDTEGEDSEEGYALPSSPEPSYSSVAAHIEETLLGLLNDLTLSEHFRPQVE
DMQLRLKHGLNWYELLPILDDLAVLMLAINNGDQQEFSSYLKQLNERLESFQSHLQAASE
DHAENQSSARDLNEQLREQVGGLQSSVQDAYDLNSLKQVLDNRFEGLLSTMDNYQLKRDE
REREVASRLQGLASRVASMEQEALGFRTHLEEQRQKALIDPLTGLPNRASWGERLEQEMA
DWQRDKNSLLVCILDLDHFKRINDGYGHLAGDKVLKIVANVFKKRLRPADFLARFGGEEF
VMLLPATLLGAGLTLLDELRTAVELCPFHFKGERVTITVSIGVTALRTGERSDTAIKRAD
QALYKAKENGRNRVEQG
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgaggcggagcgctggagagagaagtacctcaaaggcatcgagcagcaggat
aagctcgaaaagcgctgggacgcgcggctcgacttgttgcgccgcggtttggtgcgcagc
agcctggcggcggaaggctccgaccgcgccgtcgatgaatgcatgaaggaaatgcgcgaa
atcgtccgcagggacgacatggacgcaggtctggcagccttgattccacgccttgaaaaa
gccgtgctggactccgagcaacgccgtgaagtccgcgtcgggcaaattggctcggcactg
accgcgctggttacacagttgcaggcactgccgttgactcgagaggtgcgcaaacccctc
aagcgctttgccaaggaccttgaagagcgggcggcgcaagcacgcgagttgccactgctg
ctcagcgagttgagcggcttgcaggggcaggccctgactcagcttgaaaaacaggatgaa
ggccagcgcccggggcttctgcaacgcctgttcggctcacgggacgagcacggtaacgag
catcctcctgaagcggcccatccgcaaagccttccgcccgcgcaggaaatgcacgacgaa
gttcacgagcccccagaggcacccgacgcacaggccccgacatcgcctgcgcctgccgct
ctggaaagagagatcgagagcaaacctgcggtgccagcgcccgagcccaacgctgaaaca
cccgccctgacgaacactgtggaacctgtgccaccgccagcggctgtttcggtcgctcca
gtgccggtagaaattaccgtcgaacctgccagcgtgcccgtggagcatatcgatacaacc
gacatgctggcgcccacgcccatcgtgccctatcagcaacgccctgcccccgccgcccta
gaggtggagccggaagacgaccccgagccagacaccgaaggtgaagacagcgaagagggt
tatgcactgccctcctctccggagccaagctacagttcggtcgccgcacacatcgaagaa
acgctgctgggcctgctcaacgacctgaccctgtcagagcatttccggccgcaagtcgaa
gacatgcagttgcgcctgaaacatggcttgaactggtacgaactgctaccgatcctcgac
gatctggctgtgctgatgctggcgatcaacaacggtgaccagcaggaattcagcagctat
ctcaagcagctcaacgagcgcctcgagtctttccagagccacttgcaggccgccagtgaa
gaccatgccgagaaccagtccagcgcgcgtgacctgaacgaacagttgcgcgagcaggtt
ggcggcttgcaaagcagtgtgcaggacgcgtacgacctgaacagcctcaagcaagtgctc
gacaaccgttttgaaggcttgctgagtaccatggataactaccagctcaagcgcgacgag
cgcgagcgggaagttgcctcacgcctgcaaggcctggcctcacgtgtcgcgagcatggag
caggaagcgttggggttcaggacccatctggaagaacagcgccagaaagccttgatcgac
ccgcttaccggcctgcccaatcgcgcctcctggggtgagcgcctggagcaggaaatggct
gattggcagcgggataagaacagcctgctggtgtgcatactcgatctggatcatttcaag
cgtatcaacgacggttacggccacctggccggcgataaagtgttgaaaattgtcgccaac
gtcttcaaaaagcgcctgcgccccgccgactttctcgcaaggtttggtggcgaagagttt
gtcatgctgctgccggcgacgcttctcggcgcagggctgacattactcgacgaactgcgc
actgcggtcgagctgtgtccattccacttcaaaggcgagcgagtgacaatcaccgtctcc
atcggcgtgaccgcattgcgcaccggtgagcgaagcgataccgccattaaacgcgccgac
caggctttgtataaagccaaggaaaacgggcgcaaccgggtcgagcaaggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system