KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0414Help
Entry
PSPTO_0414        CDS       T00118                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:pst00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    PSPTO_0414 (mutM)
Enzymes [BR:pst01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     PSPTO_0414 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     PSPTO_0414 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
461218..462030
Genome map
AA seq 270 aa AA seqDB search
MPELPEVETTRRGIAPHLEGQRVSRVIVRDGRLRWPVPEDLDIRLSGQRIVQVSRRAKYL
LIQAEVGTLISHLGMSGNLRLVEAGLAALKHEHVDIELESGLALRYTDPRRFGAMLWSHD
PHNHELLIRLGPEPLTDLFDGERLYERSRGKSIAVKPFIMDNAVVVGVGNIYATEALFAA
GIDPRREARGISRARYLKLAIEIKRILAYAIERGGTTLRDFIGGDGKPGYFQQELFAYGR
GGQPCKVCGTTLREIKLGQRASVYCPKCQR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaagtcgaaaccacccgccgtggcattgcgccccacctcgaaggc
cagcgcgtcagccgcgtgatcgtgcgtgatggccgtctgcgctggcccgttcccgaggac
ctggacatccgtctttccgggcagcgcatcgttcaggtgagtcgccgcgccaagtacctg
ctgattcaggccgaagtgggcacgttgatcagccatttgggcatgtcgggcaatctgcgt
ctcgtcgaggcggggcttgcggcgctcaaacacgagcacgtcgatatcgagctggaatcc
gggctggcgctgcgttacaccgacccgcgtcgtttcggggcgatgctttggagtcatgat
ccgcataatcacgaattgttgatccgtcttggtcccgagccgctgaccgatctgttcgac
ggcgagcgtctttacgagcgctcgcgcggcaagtcgattgccgtaaagccgttcatcatg
gacaacgccgtggtggtgggcgtgggcaatatctacgcgacagaagcgctgtttgcggcg
ggcatcgaccctcggcgcgaagccagggggatttccagggcgcgttacctgaagctggcc
atcgagatcaaacgcattttggcgtatgccattgagcgcggtggcacgacgttgcgcgac
ttcatcggcggcgatggcaagcccggctattttcagcaggaattgtttgcctatgggcgc
ggcggtcagccttgcaaggtctgtggcacaacgttgcgcgagatcaagttgggccagcgc
gccagcgtttactgtcccaagtgccagcgctga

DBGET integrated database retrieval system