KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0455Help
Entry
PSPTO_0455        CDS       T00118                                 

Gene name
fdhA-1
Definition
(RefSeq) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00625  Chloroalkane and chloroalkene degradation
pst00680  Methane metabolism
pst01100  Metabolic pathways
pst01120  Microbial metabolism in diverse environments
pst01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    PSPTO_0455 (fdhA-1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSPTO_0455 (fdhA-1)
Enzymes [BR:pst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     PSPTO_0455 (fdhA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 1182064
NCBI-ProteinID: NP_790304
UniProt: Q88AD7
Position
complement(497858..499057)
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGAGKVEVQSIPFPKMEDPRGKRIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVLEAGRDVEHLKVGDLVSVPFNVACGRCRSCKEQNTGVCLTVNPARP
GGAYGYVDMGDWVGGQAEYVLVPYADFNLLKLPDRDAAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYVAGAGPVGLAAAASARLLGAAVVIVGDVNPTRLIHAKAQGFEIADLSQD
TPLHEQIAALLGEPEVDCAIDAVGFEARGHGHAGAQAEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRLGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRIKIA
DVVGVEVISLDDAPRGYGEFDAGVPKKFVIDPHGLFGGV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaatcgcggtgtagtttatctcggcgctggcaaggtcgaagtgcaatccatc
cccttcccgaaaatggaagacccacgcggcaagcgcatcgaacatggcgtcatcctgcgc
gttgtttccaccaatatctgcggctccgatcagcacatggtacgtggccgcacgacggcg
caaaccgggctggtgctggggcatgaaatcaccggcgaagtgctggaagccggtcgcgat
gtcgagcatctcaaggtcggtgatctggtttccgtaccgttcaacgtggcgtgcggtcgt
tgccgcagttgcaaggagcaaaacaccggcgtctgcctgacggtcaacccggctcgcccc
ggcggggcctacggttatgtcgatatgggcgactgggtcggcggtcaggctgaatacgtg
ctggtgccttacgcagacttcaacctgctgaaactcccggaccgcgatgcggcgatggag
aagattcgcgacctgacctgcctgtccgacatcctgcccaccggctaccacggcgcagtg
accgcaggcgttggccctggcagcacggtctacgttgcaggcgctggcccggtcggtctg
gctgcggctgcttccgcgcgcttgttgggcgcggcagtggtgatcgtcggtgacgtcaac
ccgacccgcctgatccacgccaaggcccagggtttcgagattgccgacctgtctcaggac
acgccgctgcacgaacagatcgctgccctgcttggcgaaccggaagtcgactgcgccatc
gacgccgtgggctttgaagcacgcggccacggtcacgcaggcgctcaggccgaagcacct
gccaccgtgctcaactcattgatgggcgtggtgcgtgtagcaggcaagatcggcatcccc
ggcctgtacgtcaccgaagacccgggtgccgtggacgccgccgcaaaaatgggcagtctg
agcatccgccttggcctgggctgggccaaatcccacagcttccacaccggccagacaccg
gtcatgaaatacaaccgccaactgatgcaagccatcatgtgggaccgcatcaagatcgcc
gacgtggtgggtgtcgaggtgatcagcctggacgatgcgccgcgtggttatggcgagttt
gatgcgggcgtgccgaagaagtttgtgattgatccgcatgggttgtttggtggggtgtag

DBGET integrated database retrieval system