KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0480Help
Entry
PSPTO_0480        CDS       T00118                                 

Gene name
glcB-1
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPTO_0480 (glcB-1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSPTO_0480 (glcB-1)
   00630 Glyoxylate and dicarboxylate metabolism
    PSPTO_0480 (glcB-1)
Enzymes [BR:pst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PSPTO_0480 (glcB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(525681..527858)
Genome map
AA seq 725 aa AA seqDB search
MTEYVQVGDLQVARVLFDFVQNEATPGTGVDAGAFWAGADQLIHDLAPKNKALLAQRDEL
QAQIDAWHQSRAGQAHDASAYKAFLQEIGYLLPEAADFQITTQNVDEEIATMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDAISEEGGAEKGKGYNKVRGDKVIAFARAFLDQAA
PLAAGSHVDSTAYKLIDGRLVISLKGGSNTGLRDDAQLVGFQGDASAPFAVLFKHNGLHF
ELQIDAASPVGQTDPAGVKDIVMEAALTTIMDCEDSIAAVDADDKVVVYRNWLGLMKGDL
VESVSKGGETFTRTMNPDRVYTTPQGGEVTLHGRSLLFIRNVGHLMTIDAILDKHGNEVP
EGILDGLLTSLAAIHNLNGNNTRSNSRSGSMYIVKPKMHGPQEAAFTNELFGRIEQVLGL
PRNTLKVGIMDEERRTTVNLKACIQAASERVVFINTGFLDRTGDEIHTSMEAGPVVRKAQ
MKAEKWISAYENSNVDIGLKCGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAAALHALHYHKVDVFARQAELAQREQASVDDILTIPLALNTDWTPEQVQNELDNNA
QGILGYVVRWIDQGVGCSKVPDINDIGLMEDRATLRISSQHMTNWLRHGIVTETQVLESL
KRMAPVVDRQNANDPLYRPLSPDFDSNIAFQAAVELVIEGTRQPNGYTEPVLHRRRREFK
AKNRV
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtacgttcaagtcggtgacctgcaagtcgccagagtcctgttcgacttcgtg
cagaacgaagcaacccccggaaccggcgtcgatgcgggcgcattctgggccggtgcggac
caactgatccacgacctcgcgccaaagaacaaggcactgctcgcccagcgtgatgaattg
caggcgcagatcgatgcctggcaccagtcgcgtgctggccaggcgcacgacgcctcggct
tacaaagccttccttcaggagatcggctatctgctgccagaagcggcggactttcagatc
accacgcaaaacgtcgacgaagaaattgccaccatggctggcccgcaactggtcgtgccg
gtgatgaacgcacgcttcgcgctcaacgcatcgaatgcacgctggggctcgttgtacgat
gcgctctacggcaccgatgcaatcagcgaagaaggcggcgcggaaaaaggcaagggctac
aacaaggtgcgtggcgacaaagtcatcgccttcgcccgcgcctttcttgatcaggctgcg
ccgctggcggcaggctcgcacgttgactcgactgcttacaaattgatcgacggcagactg
gtcatcagcctcaagggcggcagcaacaccggcctgcgcgacgatgcacaactggtcggt
tttcaaggcgatgcctcggcaccgttcgccgtgctgttcaagcacaacggtctgcatttc
gaattgcagatcgacgctgcaagcccggtcggccagaccgatccggcaggcgtgaaagac
atcgtcatggaagccgcgctgacgaccatcatggactgcgaagactccatcgcggccgtc
gatgccgacgacaaagtggtcgtttaccgcaactggctgggcctgatgaaaggtgatctg
gttgaatcggtgtccaagggcggcgaaaccttcacccgcaccatgaacccggaccgggtc
tacaccacgccacaaggtggcgaagtcacgctgcacggtcgttcgttgctgttcatccgc
aacgtcggccacctgatgaccatcgacgcgattctcgacaagcatggcaacgaagtgcca
gaaggcattctcgatggcctgctgaccagtctcgctgcgatccacaacctcaacggcaat
aacacacgcagcaacagccgcagcggctcgatgtacatcgtcaaaccgaagatgcacggg
ccgcaggaagccgcgttcaccaacgagctgttcgggcgtatcgagcaggtactgggcttg
ccgcgcaacacgctgaaagtcggcatcatggacgaggagcgccgtaccacggtcaacctc
aaggcctgcattcaggccgcaagcgagcgcgtggtgttcatcaacaccggctttctggac
cgcaccggtgacgaaatccacacgtcgatggaagcaggcccggtggtgcgcaaggcgcag
atgaaagccgaaaaatggatctcggcctacgagaactccaacgtcgatatcggcctgaaa
tgcggcctgcaaggtcgtgcgcagatcggcaagggtatgtgggccatgcccgatctgatg
gccgccatgctggagcagaaaatcgcccacccgctggcaggcgcaaacaccgcctgggtg
ccatcacccaccgcggctgcgctgcatgctctgcactatcacaaggtggatgtgttcgct
cgtcaggccgaactggcccagcgcgaacaggcctcggtggatgacatcctgaccataccg
ctcgcgctgaacaccgactggacaccggaacaagtccagaacgaactggacaacaacgcc
cagggcattcttggctatgtggtgcgctggattgatcagggcgtgggttgctcgaaagtc
ccggatatcaacgacatcggcctgatggaagaccgcgccacgctgcgcatctccagccag
cacatgaccaactggctgcggcatggcatcgtcaccgaaacgcaggtactggaaagcctc
aaacgcatggcccctgtcgtggaccgccagaacgccaacgacccgctgtaccgcccactt
tcaccagacttcgacagcaacatcgccttccaggcggccgtcgaactggtcatagaaggc
acgcgacagcccaacggctacaccgagccggtgctgcatcgccgccgtcgcgagttcaag
gcgaaaaaccgggtgtaa

DBGET integrated database retrieval system